DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4c3 and CYP4F8

DIOPT Version :9

Sequence 1:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_009184.1 Gene:CYP4F8 / 11283 HGNCID:2648 Length:520 Species:Homo sapiens


Alignment Length:445 Identity:166/445 - (37%)
Similarity:250/445 - (56%) Gaps:29/445 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 WQG-TAPRVLLFEPETVEPILNSQKFVNKSH--DYDYLHPWLGEGLLTSTDRKWHSRRKILTPAF 162
            |.| ..|.:.|..|:.|..::|:...:....  .|..|.||||:|||.|...||...|::|||||
Human    91 WLGPITPIINLCHPDIVRSVINTSDAITDKDIVFYKTLKPWLGDGLLLSVGDKWRHHRRLLTPAF 155

  Fly   163 HFKILDDFIDVFNEQSAVLARK---LAVEVGSEAFNLFPYVTLCTLDIVCETAMGRRIYA-QSNS 223
            ||.||..:|.:|::.:.::..|   ||:| ||...::|.:::|.|||     ::.:.|:: .||.
Human   156 HFNILKPYIKIFSKSANIMHAKWQRLAME-GSTCLDVFEHISLMTLD-----SLQKCIFSFDSNC 214

  Fly   224 E---SEYVKAVYGIGSIVQSRQAKIWLQSDFIFSLTAEYKLHQSYINTLHGFSNMVIRERKAELA 285
            :   |||:.|:..:.::|..|..:.:...||::.||...:........:|.|::.||:||:..| 
Human   215 QEKPSEYITAIMELSALVVKRNNQFFRYKDFLYFLTPCGRRFHRACRLVHDFTDAVIQERRRTL- 278

  Fly   286 ILQENNNNNNNNAPDAYDDVGKKKRLAFLD-LLIDASKEGTVLSNEDIREEVDTFMFEGHDTTSA 349
                    .:....|......|.|.|.|:| ||:...|.|..||:||||.|.|||||.|||||::
Human   279 --------TSQGVDDFLQAKAKSKTLDFIDVLLLSEDKNGKELSDEDIRAEADTFMFGGHDTTAS 335

  Fly   350 AISWTLFLLGCHPEYQERVVEELDSIFGDDKETPATMKNLMDMRYLECCIKDSLRLFPSVPMMAR 414
            .:||.|:.|..|||||||..:|:..:..|.:.......:|..:.:|..|:|:||||.|.:|..||
Human   336 GLSWVLYNLARHPEYQERCRQEVQELLKDREPKEIEWDDLAQLPFLTMCLKESLRLHPPIPTFAR 400

  Fly   415 MVGEDVNI-GGKIVPAGTQAIIMTYALHRNPRVFPKPEQFNPDNFLPENCAGRHPFAYIPFSAGP 478
            ...:||.: ..:::|.|....|..:|:|.||.|:|.||.::|..|.|||...|.|.|:|||||||
Human   401 GCTQDVVLPDSRVIPKGNVCNINIFAIHHNPSVWPDPEVYDPFRFDPENAQKRSPMAFIPFSAGP 465

  Fly   479 RNCIGQKFAILEEKAVISTVLRKYKIEAVDRREDLTLLGELILRPKDGLRVKITP 533
            |||||||||:.|.|.|::..|.:::| ..|.||. ....|::||.:|||.:::.|
Human   466 RNCIGQKFAMAEMKVVLALTLLRFRI-LPDHREP-RRTPEIVLRAEDGLWLRVEP 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 165/441 (37%)
CYP4F8NP_009184.1 p450 52..504 CDD:306555 159/429 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154671
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.