DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4c3 and cyp4f3

DIOPT Version :9

Sequence 1:NP_524598.1 Gene:Cyp4c3 / 43663 FlyBaseID:FBgn0015032 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001083010.1 Gene:cyp4f3 / 100037390 ZFINID:ZDB-GENE-070410-108 Length:511 Species:Danio rerio


Alignment Length:531 Identity:150/531 - (28%)
Similarity:261/531 - (49%) Gaps:56/531 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GQVISGYSPITVFLLGSILIFLVVYNKRRSRLVKYIEKIPGPAAMPFLGNAIEMNVDHDELFNRV 84
            |..::|...::|..|...|:..::.|:|..|.                       .:...|.|.:
Zfish     4 GLSVTGILALSVAALLCALVTRIIINRRALRC-----------------------FNQPPLRNWI 45

  Fly    85 IGMQKLWG-TRIGINRV------------WQGTAP---RVLLFEPETVEPILNSQKFVNKSHD-- 131
            :|...|.| ...|:.||            | ...|   .|.||.|:.:..:|.:...:.....  
Zfish    46 MGHMGLMGHNEEGLQRVDDLVCKYGHSCSW-FLGPFYNMVRLFHPDYIRSLLTASASITLKDRIF 109

  Fly   132 YDYLHPWLGEGLLTSTDRKWHSRRKILTPAFHFKILDDFIDVFNEQSAVLA---RKLAVEVGSEA 193
            |.::.||||..||..:.::|...|::|||||||.||..::.:||:.:.::.   |:|..: |..:
Zfish   110 YGFMKPWLGNCLLLQSGQEWSRHRRLLTPAFHFDILKKYVHIFNQSTNIMHDEWRRLLAK-GEHS 173

  Fly   194 FNLFPYVTLCTLDIVCETAMGRRIYAQSNSESEYVKAVYGIGSIVQSRQAKIWLQSDFIFSLTAE 258
            .::|..::..|||.:.:.......::|.... :|:.|:..:..::..||..:....|:::..:|:
Zfish   174 VDMFEQISSLTLDSLLKCTFSCDTHSQEKPR-QYISAILDLSRLLVQRQHYLPYHWDWLYWRSAQ 237

  Fly   259 YKLHQSYINTLHGFSNMVIRERKAELAILQENNNNNNNNAPDAYDDVGKKKRLAFLDLLIDASKE 323
            .:..|.....:|.|:..:::||:.:|     :..::..:.|:......|:|....:|||:.|..:
Zfish   238 GRRFQQACAVVHQFTADIVQERRTQL-----DQQSDPESHPENTGRYRKRKNTDLIDLLLLAKDD 297

  Fly   324 -GTVLSNEDIREEVDTFMFEGHDTTSAAISWTLFLLGCHPEYQERVVEELDSIFGDDKETPATMK 387
             |..|:||:|:...|.|||.|||||::|:||..:.|..:.:||||...|:..:..|........:
Zfish   298 KGEGLTNEEIKAHADMFMFAGHDTTASALSWIFYNLAMNQDYQERCRAEVRDLLADRDTHTIGWE 362

  Fly   388 NLMDMRYLECCIKDSLRLFPSVPMMARMVGEDVNIGGK-IVPAGTQAIIMTYALHRNPRVFPKPE 451
            :|..:.:...|||:||||...|..:.|...:::...|. ::|.|...:|..|.:||||:|:|.|.
Zfish   363 DLSQLTFTTMCIKESLRLHSPVLALTRYYSQNMKTPGDCVIPHGCLCLISIYGVHRNPQVWPDPL 427

  Fly   452 QFNPDNFLPENCAGRHPFAYIPFSAGPRNCIGQKFAILEEKAVISTVLRKYKIEAVDRREDLTLL 516
            .|:|..|.|.|...|.|.|:|||||||||||||.||:.|.|.|::..|.::||  :...:.:..|
Zfish   428 VFDPTRFDPHNSDSRSPHAFIPFSAGPRNCIGQNFAMAEMKVVVALTLARFKI--LPGPKPVRRL 490

  Fly   517 GELILRPKDGL 527
            .:|:||.:.|:
Zfish   491 YQLVLRAEGGM 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4c3NP_524598.1 p450 59..531 CDD:278495 142/492 (29%)
cyp4f3NP_001083010.1 p450 38..503 CDD:278495 142/474 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.