DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sap-r and AT5G01800

DIOPT Version :9

Sequence 1:NP_524597.1 Gene:Sap-r / 43662 FlyBaseID:FBgn0000416 Length:953 Species:Drosophila melanogaster
Sequence 2:NP_195800.1 Gene:AT5G01800 / 831924 AraportID:AT5G01800 Length:217 Species:Arabidopsis thaliana


Alignment Length:219 Identity:51/219 - (23%)
Similarity:85/219 - (38%) Gaps:33/219 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FSNSKECRATRHCIQTVWETQKVPVDTDSICTICKDMVTQARDQLKSNQTEEELKEVFEGSCKLI 106
            |..|..|.||...:...:|:..   |.:.:|.:|...||...|.|:....:.||.|....||..|
plant    12 FLLSWSCHATNPILLEPFESAH---DDNQVCELCDKYVTLVIDYLQDYDNQNELVEALHISCSQI 73

  Fly   107 PIKPIQKECIKVADDFLPELVEALASQMNPDQVCSVAGLCNSARIDELYKNGIQAGLDGTVQNED 171
            |  |::|:|:.:.|.: .:|.....|.:..||:|....||.:.                      
plant    74 P--PLKKQCLSMVDHY-TQLFFTQVSTIKSDQICKRLNLCQAV---------------------- 113

  Fly   172 DSSEETELAMQPNQLSCGNC-NLLSRLMHSKFAATDRDDMVETMLHMCGSLSSFSDACANIVLTY 235
                ....|.|.:|.:|..| ..:|.::........:..::..:|..|.||:::.|.|..:|..|
plant   114 ----TPAFASQVHQGNCEACRETVSEVVTKLKDPETKLKIIRLLLKECKSLNNYQDKCKKMVFEY 174

  Fly   236 FNDIYDHVSKHLTTDAVCHVSGVC 259
            ...:...:.|.|....||.:..||
plant   175 GPLMLTDLQKFLEKKDVCTILHVC 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sap-rNP_524597.1 SapA 27..59 CDD:295328 5/16 (31%)
SapB 70..146 CDD:214797 22/75 (29%)
SapB_1 72..106 CDD:282970 11/33 (33%)
SapB_2 115..146 CDD:281486 7/30 (23%)
SapB 186..259 CDD:214797 15/73 (21%)
SapB_2 228..259 CDD:281486 7/30 (23%)
SapB 285..359 CDD:214797
SapB_1 287..320 CDD:282970
SapB_2 328..359 CDD:281486
SapB 436..510 CDD:214797
SapB_1 437..471 CDD:282970
SapB_2 479..510 CDD:281486
SapB 535..610 CDD:214797
SapB_1 537..571 CDD:282970
SapB_2 579..610 CDD:281486
SapB 666..739 CDD:214797
SapB_1 666..700 CDD:282970
SapB_2 708..739 CDD:281486
SapB 775..849 CDD:214797
SapB_1 777..811 CDD:282970
SapB_2 819..849 CDD:281486
SapB 859..938 CDD:214797
AT5G01800NP_195800.1 SapB 38..110 CDD:214797 22/74 (30%)
SapB 126..198 CDD:214797 15/71 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D865505at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102385
Panther 1 1.100 - - O PTHR11480
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.