| Sequence 1: | NP_524597.1 | Gene: | Sap-r / 43662 | FlyBaseID: | FBgn0000416 | Length: | 953 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_001334098.4 | Gene: | sftpba / 794185 | ZFINID: | ZDB-GENE-091204-378 | Length: | 221 | Species: | Danio rerio |
| Alignment Length: | 237 | Identity: | 53/237 - (22%) |
|---|---|---|---|
| Similarity: | 86/237 - (36%) | Gaps: | 57/237 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 650 LPPQLAFDPGFTAAPNCLICEELVKTLEKRMGKHPTRDSIKHILEESCDRMRKPMNTKCHKVIDK 714
Fly 715 YGDKIADLLLKEMDPKLICTELGMCILADLDDLEVDEALKYDVIALPRQDNKLSSSIKEPPTCVL 779
Fly 780 CEFIMTKLDADLKNKTEQDDIKRAIEAVCNRLPATVRKQCDTFVDGYASAVLKLLSDVPPKQ--- 841
Fly 842 --VCQKLQLC-------------------FSVAVTDEVLECG 862 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Sap-r | NP_524597.1 | SapA | 27..59 | CDD:295328 | |
| SapB | 70..146 | CDD:214797 | |||
| SapB_1 | 72..106 | CDD:282970 | |||
| SapB_2 | 115..146 | CDD:281486 | |||
| SapB | 186..259 | CDD:214797 | |||
| SapB_2 | 228..259 | CDD:281486 | |||
| SapB | 285..359 | CDD:214797 | |||
| SapB_1 | 287..320 | CDD:282970 | |||
| SapB_2 | 328..359 | CDD:281486 | |||
| SapB | 436..510 | CDD:214797 | |||
| SapB_1 | 437..471 | CDD:282970 | |||
| SapB_2 | 479..510 | CDD:281486 | |||
| SapB | 535..610 | CDD:214797 | |||
| SapB_1 | 537..571 | CDD:282970 | |||
| SapB_2 | 579..610 | CDD:281486 | |||
| SapB | 666..739 | CDD:214797 | 23/72 (32%) | ||
| SapB_1 | 666..700 | CDD:282970 | 11/33 (33%) | ||
| SapB_2 | 708..739 | CDD:281486 | 12/30 (40%) | ||
| SapB | 775..849 | CDD:214797 | 14/78 (18%) | ||
| SapB_1 | 777..811 | CDD:282970 | 5/33 (15%) | ||
| SapB_2 | 819..849 | CDD:281486 | 7/34 (21%) | ||
| SapB | 859..938 | CDD:214797 | 3/4 (75%) | ||
| sftpba | XP_001334098.4 | SapB | 18..91 | CDD:214797 | 23/72 (32%) |
| SapB_2 | 60..91 | CDD:281486 | 12/30 (40%) | ||
| SapB | 106..178 | CDD:214797 | 14/76 (18%) | ||
| SapA | 189..219 | CDD:280378 | 4/22 (18%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C170580264 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1340 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 1 | 1.010 | - | - | QHG54430 | |
| OrthoDB | 1 | 1.010 | - | - | D277021at33208 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0004597 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | LDO | PTHR11480 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 7 | 6.860 | |||||