DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sap-r and SFTPB

DIOPT Version :9

Sequence 1:NP_524597.1 Gene:Sap-r / 43662 FlyBaseID:FBgn0000416 Length:953 Species:Drosophila melanogaster
Sequence 2:XP_005264544.1 Gene:SFTPB / 6439 HGNCID:10801 Length:393 Species:Homo sapiens


Alignment Length:383 Identity:81/383 - (21%)
Similarity:151/383 - (39%) Gaps:55/383 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLAVLALCCAFGVFAAATPLLGSSKCTWGPSYWCGNFSNSKECRATRHCIQTVWETQKVPVDTDS 70
            ||.:|...|..|..|..|   .|..|..||.:||.:...:.:|||..||:|.||.    .|..|.
Human    22 LLLLLPTLCGPGTAAWTT---SSLACAQGPEFWCQSLEQALQCRALGHCLQEVWG----HVGADD 79

  Fly    71 ICTICKDMVTQARDQLKSNQTEEELKEVFEGSCKLIPIKPIQKECIKVADDFLPELVEALASQMN 135
            :|..|:|:|.......|....::.:::..|..|.::|:|.:..:|.:|.||:.|.:::...:|.:
Human    80 LCQECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYFPLVIDYFQNQTD 144

  Fly   136 PDQVCSVAGLCNSARIDELYKNGIQAGLDGTVQN--EDDSSEETELAMQPNQLS----------- 187
            .:.:|...|||.|.:.:...:.|:...|...:::  .|...::..|.:.|..|.           
Human   145 SNGICMHLGLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLS 209

  Fly   188 ----------CGNCN-LLSRLMHSKFAATDRDDMVETMLHMCGSLSSFSDA-CANIVLTYFNDIY 240
                      |..|. |:.|:.    |...:..:...:..:|..:...:.. |..:...|...:.
Human   210 EQQFPIPLPYCWLCRALIKRIQ----AMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILL 270

  Fly   241 DHVSKHLTTDAVCHVSGVCASRYHQHEEEKQPQEALVALDAGDDIP----CELCEQLVKHLRDVL 301
            |.:...:....||.:...|:.     ::...|:.     ..|:.:|    |.||..:...     
Human   271 DTLLGRMLPQLVCRLVLRCSM-----DDSAGPRS-----PTGEWLPRDSECHLCMSVTTQ----- 320

  Fly   302 VANTTETEFKQVMEGFCKQSKGFKDECLSIVDQYYHVIYETLVSKLDANGACCMIGIC 359
            ..|::|....|.|...|..|...:::|...|:|:...:...:....||:..|..:|:|
Human   321 AGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLVPRGWDAHTTCQALGVC 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sap-rNP_524597.1 SapA 27..59 CDD:295328 12/31 (39%)
SapB 70..146 CDD:214797 17/75 (23%)
SapB_1 72..106 CDD:282970 7/33 (21%)
SapB_2 115..146 CDD:281486 8/30 (27%)
SapB 186..259 CDD:214797 12/95 (13%)
SapB_2 228..259 CDD:281486 5/30 (17%)
SapB 285..359 CDD:214797 17/77 (22%)
SapB_1 287..320 CDD:282970 8/32 (25%)
SapB_2 328..359 CDD:281486 7/30 (23%)
SapB 436..510 CDD:214797
SapB_1 437..471 CDD:282970
SapB_2 479..510 CDD:281486
SapB 535..610 CDD:214797
SapB_1 537..571 CDD:282970
SapB_2 579..610 CDD:281486
SapB 666..739 CDD:214797
SapB_1 666..700 CDD:282970
SapB_2 708..739 CDD:281486
SapB 775..849 CDD:214797
SapB_1 777..811 CDD:282970
SapB_2 819..849 CDD:281486
SapB 859..938 CDD:214797
SFTPBXP_005264544.1 SapA 40..73 CDD:295328 13/32 (41%)
SapB 79..155 CDD:214797 17/75 (23%)
SapB_1 81..115 CDD:282970 7/33 (21%)
SapB_2 124..155 CDD:281486 8/30 (27%)
SapB 218..289 CDD:214797 11/74 (15%)
SapB 309..378 CDD:214797 16/73 (22%)
SapB_2 347..378 CDD:281486 7/30 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151494
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D277021at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11480
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.