powered by:
Protein Alignment Sap-r and T08A9.13
DIOPT Version :9
Sequence 1: | NP_524597.1 |
Gene: | Sap-r / 43662 |
FlyBaseID: | FBgn0000416 |
Length: | 953 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001033559.1 |
Gene: | T08A9.13 / 3896870 |
WormBaseID: | WBGene00044442 |
Length: | 120 |
Species: | Caenorhabditis elegans |
Alignment Length: | 50 |
Identity: | 13/50 - (26%) |
Similarity: | 23/50 - (46%) |
Gaps: | 11/50 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 789 ADLKNKTEQDDIKRAIEAVCNRLPATVRKQCDTFVDGYASAVLKLLSDVP 838
|:|:| .|.:.:::|.| |....|.:|...:|.| .:|..:|
Worm 34 AELRN-AELEKLQKAKE-----LEQRTRVECQQALDQY-----DVLKKIP 72
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1340 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.