DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sap-r and spp-21

DIOPT Version :10

Sequence 1:NP_524597.1 Gene:Sap-r / 43662 FlyBaseID:FBgn0000416 Length:953 Species:Drosophila melanogaster
Sequence 2:NP_001024927.1 Gene:spp-21 / 3565733 WormBaseID:WBGene00044284 Length:103 Species:Caenorhabditis elegans


Alignment Length:95 Identity:24/95 - (25%)
Similarity:43/95 - (45%) Gaps:15/95 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   522 VFNPQPASDEQDPPTCPLCLFAVEQA------QMKIRDNKSKDNIKKVLNGLCSHLPNEIKEECV 580
            ||..|.||...    |.||..||:.|      :..|.::|.....||.|.|:     ..:::.|:
 Worm    18 VFPEQRASAFD----CFLCRLAVKTADPFVDEEFHIAEDKFLAECKKELKGI-----PFLEQTCL 73

  Fly   581 DFVNTYSNELIDMLITDFKPQEICVQLKLC 610
            :|.::....:|..|.:...|:::|..::.|
 Worm    74 NFAHSEFGPIIMELESGTAPEDVCRAIEQC 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sap-rNP_524597.1 SapA 28..60 CDD:460487
SapB 70..146 CDD:214797
SapB 186..259 CDD:214797
SapB 285..359 CDD:214797
SapB 436..510 CDD:214797
SapB 535..610 CDD:214797 18/80 (23%)
SapB 666..739 CDD:214797
SapB 775..849 CDD:214797
SapB 859..938 CDD:214797
spp-21NP_001024927.1 SapB 29..103 CDD:214797 18/78 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.