DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sap-r and spp-2

DIOPT Version :10

Sequence 1:NP_524597.1 Gene:Sap-r / 43662 FlyBaseID:FBgn0000416 Length:953 Species:Drosophila melanogaster
Sequence 2:NP_741832.1 Gene:spp-2 / 259714 WormBaseID:WBGene00004987 Length:104 Species:Caenorhabditis elegans


Alignment Length:98 Identity:27/98 - (27%)
Similarity:46/98 - (46%) Gaps:18/98 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   758 IALPRQDNKLSSSIKEPPTCVLCEFIMTKLD--ADLKNKTEQDDIKRAIEAVCNRLPATV---RK 817
            :.||::.:.|.        |.:||..:...|  || |:.|   .||:..:..|.:|...:   .:
 Worm    17 VVLPKERSSLG--------CQMCELAVKTYDGSAD-KDVT---SIKKDFDTECKKLFHAIPFAPQ 69

  Fly   818 QCDTFVDGYASAVLK-LLSDVPPKQVCQKLQLC 849
            :|:.:|:.....::| |.|...||.||:||..|
 Worm    70 ECEHYVNEKLDPIIKELESGTAPKDVCKKLGEC 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sap-rNP_524597.1 SapA 28..60 CDD:460487
SapB 70..146 CDD:214797
SapB 186..259 CDD:214797
SapB 285..359 CDD:214797
SapB 436..510 CDD:214797
SapB 535..610 CDD:214797
SapB 666..739 CDD:214797
SapB 775..849 CDD:214797 23/79 (29%)
SapB 859..938 CDD:214797
spp-2NP_741832.1 SapB 28..102 CDD:214797 23/77 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.