DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sap-r and spp-4

DIOPT Version :9

Sequence 1:NP_524597.1 Gene:Sap-r / 43662 FlyBaseID:FBgn0000416 Length:953 Species:Drosophila melanogaster
Sequence 2:NP_509237.1 Gene:spp-4 / 188266 WormBaseID:WBGene00004989 Length:103 Species:Caenorhabditis elegans


Alignment Length:96 Identity:26/96 - (27%)
Similarity:44/96 - (45%) Gaps:14/96 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   758 IALPRQDNKLSSSIKEPPTCVLCEFIMTKLDADLKNKTEQDDIKRAIEAVCNRLPATV---RKQC 819
            :.||.|.|.|.        |.:||..:.|.|..:..  :.:.||:..:..|.:|..::   .::|
 Worm    17 VVLPHQRNSLG--------CQMCELAVKKYDGSVDK--DVNGIKKDFDTECKKLFHSIPFAPQEC 71

  Fly   820 DTFVDGYASAVLK-LLSDVPPKQVCQKLQLC 849
            :.:|:.....::| |.|...||.||.||..|
 Worm    72 EHYVNTKLDPIIKELESGTAPKDVCTKLHEC 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sap-rNP_524597.1 SapA 27..59 CDD:295328
SapB 70..146 CDD:214797
SapB_1 72..106 CDD:282970
SapB_2 115..146 CDD:281486
SapB 186..259 CDD:214797
SapB_2 228..259 CDD:281486
SapB 285..359 CDD:214797
SapB_1 287..320 CDD:282970
SapB_2 328..359 CDD:281486
SapB 436..510 CDD:214797
SapB_1 437..471 CDD:282970
SapB_2 479..510 CDD:281486
SapB 535..610 CDD:214797
SapB_1 537..571 CDD:282970
SapB_2 579..610 CDD:281486
SapB 666..739 CDD:214797
SapB_1 666..700 CDD:282970
SapB_2 708..739 CDD:281486
SapB 775..849 CDD:214797 20/77 (26%)
SapB_1 777..811 CDD:282970 8/33 (24%)
SapB_2 819..849 CDD:281486 11/30 (37%)
SapB 859..938 CDD:214797
spp-4NP_509237.1 SapB 28..102 CDD:214797 20/75 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D277021at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.