powered by:
Protein Alignment Sap-r and spp-13
DIOPT Version :9
Sequence 1: | NP_524597.1 |
Gene: | Sap-r / 43662 |
FlyBaseID: | FBgn0000416 |
Length: | 953 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001370643.1 |
Gene: | spp-13 / 184191 |
WormBaseID: | WBGene00004998 |
Length: | 125 |
Species: | Caenorhabditis elegans |
Alignment Length: | 72 |
Identity: | 21/72 - (29%) |
Similarity: | 39/72 - (54%) |
Gaps: | 4/72 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 72 CTICKDMVTQARDQLKSNQTEEELKEVFEGSCKLIPIKPIQKE--CIKVADDFLPELVEALASQM 134
||.||::|...|..:.::..||: ||.|..|..|.....:|| |.::..:.||::::.:.:.:
Worm 53 CTTCKEIVNFTRMLILNHVPEEQ--EVMEKVCYRIFGDDKKKESFCEELIKEELPDIIKYVRNHL 115
Fly 135 NPDQVCS 141
.|.|.|:
Worm 116 EPKQACA 122
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR11480 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.