DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Sap-r and LOC103910580

DIOPT Version :9

Sequence 1:	NP_524597.1	Gene:	Sap-r / 43662	FlyBaseID:	FBgn0000416	Length:	953	Species:	Drosophila melanogaster
Sequence 2:	XP_021326484.1	Gene:	LOC103910580 / 103910580	-ID:	-	Length:	196	Species:	Danio rerio

Alignment Length:	138	Identity:	37/138 - (26%)
Similarity:	57/138 - (41%)	Gaps:	30/138 - (21%)

- Green bases have known domain annotations that are detailed below.

  Fly    66 VDTDSICTICKDMVTQARDQLKSNQTEEELKEVFEGSCKLIPIK--PIQKECIKVADDFLPELVE 128
            :|...|..:.||:|:....|.|.|:.  .|...|:.:|..:|.|  ||   |....|..||..:.
Zfish    48 LDCTQIFELLKDLVSNLDFQEKQNKA--RLIATFDQACDSLPPKFAPI---CHNQVDKLLPLAMT 107

  Fly   129 ALASQMNPDQVCSVAGLC---NSARIDELYKNGIQAGLDGTVQNEDDSSEETELAMQPNQL---- 186
            .:.:.|||.::|:..|||   :|.:|.:|..|.:..  .||              |.|.|:
Zfish   108 FITNFMNPSEICTYLGLCGGRDSGKIKDLLLNHMSK--TGT--------------MPPMQMESSV 156

  Fly   187 SCGNCNLL 194
            .|..|..:
Zfish   157 QCSVCTYI 164

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Sap-r	NP_524597.1	SapA	27..59	CDD:295328
		SapB	70..146	CDD:214797	23/77 (30%)
		SapB_1	72..106	CDD:282970	9/33 (27%)
		SapB_2	115..146	CDD:281486	9/30 (30%)
		SapB	186..259	CDD:214797	2/13 (15%)
		SapB_2	228..259	CDD:281486
		SapB	285..359	CDD:214797
		SapB_1	287..320	CDD:282970
		SapB_2	328..359	CDD:281486
		SapB	436..510	CDD:214797
		SapB_1	437..471	CDD:282970
		SapB_2	479..510	CDD:281486
		SapB	535..610	CDD:214797
		SapB_1	537..571	CDD:282970
		SapB_2	579..610	CDD:281486
		SapB	666..739	CDD:214797
		SapB_1	666..700	CDD:282970
		SapB_2	708..739	CDD:281486
		SapB	775..849	CDD:214797
		SapB_1	777..811	CDD:282970
		SapB_2	819..849	CDD:281486
		SapB	859..938	CDD:214797
LOC103910580	XP_021326484.1	SapB	47..125	CDD:214797	24/81 (30%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D277021at33208
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.010