DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15547 and ndk

DIOPT Version :10

Sequence 1:NP_651833.1 Gene:CG15547 / 43661 FlyBaseID:FBgn0039809 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_417013.1 Gene:ndk / 945611 ECOCYCID:EG10650 Length:143 Species:Escherichia coli


Alignment Length:132 Identity:36/132 - (27%)
Similarity:58/132 - (43%) Gaps:18/132 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ENSLFIIKPDYLHKR--RPVLLKLLAEGFQIQGNRRIAFSPETAAEFYADYADEKGFMLEVILLS 65
            |.:..||||:.:.|.  ..:..:..|.||:|.|.:.:..:.|.|..|||::..:..|...|..::
E. coli     4 ERTFSIIKPNAVAKNVIGNIFARFEAAGFKIVGTKMLHLTVEQARGFYAEHDGKPFFDGLVEFMT 68

  Fly    66 KGVSEAFIVTKENAVQ---ELL-----------NIMICYFGSASDLERNIHVTKNSYSVAREINF 116
            .|.....::..|||||   :||           .:...|..|.:  |...|.:.:..|.||||.:
E. coli    69 SGPIVVSVLEGENAVQRHRDLLGATNPANALAGTLRADYADSLT--ENGTHGSDSVESAAREIAY 131

  Fly   117 IF 118
            .|
E. coli   132 FF 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15547NP_651833.1 NDPk 3..119 CDD:469726 36/132 (27%)
ndkNP_417013.1 Ndk 2..141 CDD:439875 36/132 (27%)

Return to query results.
Submit another query.