DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15547 and YNK1

DIOPT Version :9

Sequence 1:NP_651833.1 Gene:CG15547 / 43661 FlyBaseID:FBgn0039809 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_012856.1 Gene:YNK1 / 853798 SGDID:S000001550 Length:153 Species:Saccharomyces cerevisiae


Alignment Length:130 Identity:28/130 - (21%)
Similarity:55/130 - (42%) Gaps:14/130 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ENSLFIIKPDYLHKR--RPVLLKLLAEGFQIQGNRRIAFSPETAAEFYADYADEKGFMLEVILLS 65
            |.:...:|||.:.:.  ..:|.:...:|:::...:.:....:...:.||::..:..|...|..:.
Yeast     6 ERTFIAVKPDGVQRGLVSQILSRFEKKGYKLVAIKLVKADDKLLEQHYAEHVGKPFFPKMVSFMK 70

  Fly    66 KGVSEAFIVTKENAVQELLNIMICY--FGSAS---------DLERNI-HVTKNSYSVAREINFIF 118
            .|...|.:...::.|::...|:...  .|||.         ||.||: |.:.:..|..||||..|
Yeast    71 SGPILATVWEGKDVVRQGRTILGATNPLGSAPGTIRGDFGIDLGRNVCHGSDSVDSAEREINLWF 135

  Fly   119  118
            Yeast   136  135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15547NP_651833.1 NDK 3..120 CDD:197791 28/130 (22%)
NDPk 3..119 CDD:260363 28/130 (22%)
YNK1NP_012856.1 NDPk 4..152 CDD:351036 28/130 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.