Sequence 1: | NP_651833.1 | Gene: | CG15547 / 43661 | FlyBaseID: | FBgn0039809 | Length: | 390 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_445959.1 | Gene: | Nme3 / 85269 | RGDID: | 619879 | Length: | 169 | Species: | Rattus norvegicus |
Alignment Length: | 73 | Identity: | 14/73 - (19%) |
---|---|---|---|
Similarity: | 31/73 - (42%) | Gaps: | 2/73 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 ENSLFIIKPDYLHKR--RPVLLKLLAEGFQIQGNRRIAFSPETAAEFYADYADEKGFMLEVILLS 65
Fly 66 KGVSEAFI 73 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15547 | NP_651833.1 | NDK | 3..120 | CDD:197791 | 14/73 (19%) |
NDPk | 3..119 | CDD:260363 | 14/73 (19%) | ||
Nme3 | NP_445959.1 | NDK | 22..156 | CDD:278749 | 14/73 (19%) |
NDPk_I | 22..151 | CDD:239876 | 14/73 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0105 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |