DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15547 and NME5

DIOPT Version :9

Sequence 1:NP_651833.1 Gene:CG15547 / 43661 FlyBaseID:FBgn0039809 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_016865434.1 Gene:NME5 / 8382 HGNCID:7853 Length:278 Species:Homo sapiens


Alignment Length:224 Identity:55/224 - (24%)
Similarity:96/224 - (42%) Gaps:29/224 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ENSLFIIKPDYLHKRRPVLLKLLAEGFQIQGNRRIAFSPETAAEFYADYADEKGFMLEVILLSKG 67
            |.:|.|||||.:.|...:...:|..||.|...|::..|||..:.||.:...:..|......:|.|
Human    13 EKTLAIIKPDIVDKEEEIQDIILRSGFTIVQRRKLRLSPEQCSNFYVEKYGKMFFPNLTAYMSSG 77

  Fly    68 VSEAFIVTKENAVQ---ELL---NIMI----------CYFGSASDLERNIHVTKNSYSVAREINF 116
            ...|.|:.:..|:.   |||   |.::          ..:|: .||...:|.:.:..:..|||.|
Human    78 PLVAMILARHKAISYWLELLGPNNSLVAKETHPDSLRAIYGT-DDLRNALHGSNDFAAAEREIRF 141

  Fly   117 IFPNYIHEPHQMFD-HNNFCNRPMLKPLLEEIYDIMQNTD---------CSQENWKVRVSDYLVR 171
            :||..|.||..:.. ..::.|..::..|||.:.::.:...         |.:|:|.:|....:..
Human   142 MFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQKPADPLFWYMCCRREHWTLRSILLVCM 206

  Fly   172 SNPKM--PEISNQCQQRPDVAIQDKSQQT 198
            |..:|  |..::.|.......|:..:|.:
Human   207 SGIRMSLPHCADYCSFVEGFEIESTNQSS 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15547NP_651833.1 NDK 3..120 CDD:197791 37/132 (28%)
NDPk 3..119 CDD:260363 36/131 (27%)
NME5XP_016865434.1 NDPk5 13..144 CDD:239880 36/131 (27%)
Dpy-30 156..>187 CDD:310056 4/30 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159276
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2482
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105512
Panther 1 1.100 - - LDO PTHR46161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.690

Return to query results.
Submit another query.