DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15547 and NDPK2

DIOPT Version :10

Sequence 1:NP_651833.1 Gene:CG15547 / 43661 FlyBaseID:FBgn0039809 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_568970.2 Gene:NDPK2 / 836451 AraportID:AT5G63310 Length:231 Species:Arabidopsis thaliana


Alignment Length:64 Identity:15/64 - (23%)
Similarity:31/64 - (48%) Gaps:4/64 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ENSLFIIKPDYLHKR--RPVLLKLLAEGFQIQGNRRIAFSPETAAEFYADYADEKGF--MLEVI 62
            |.:..::|||.:.:.  ..::.:...:||::.|.:......|.|.|.|.|.:.:..|  ::|.|
plant    84 EETYIMVKPDGIQRGLVGEIISRFEKKGFKLIGLKMFQCPKELAEEHYKDLSAKSFFPNLIEYI 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15547NP_651833.1 NDPk 3..119 CDD:469726 15/64 (23%)
NDPK2NP_568970.2 NDPk_I 84..213 CDD:239876 15/64 (23%)

Return to query results.
Submit another query.