DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15547 and AT4G23900

DIOPT Version :10

Sequence 1:NP_651833.1 Gene:CG15547 / 43661 FlyBaseID:FBgn0039809 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_567690.1 Gene:AT4G23900 / 828490 AraportID:AT4G23900 Length:237 Species:Arabidopsis thaliana


Alignment Length:81 Identity:17/81 - (20%)
Similarity:34/81 - (41%) Gaps:2/81 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ENSLFIIKPDYLHKR--RPVLLKLLAEGFQIQGNRRIAFSPETAAEFYADYADEKGFMLEVILLS 65
            |.:...||||.:.:.  ..::.:...:|:::.|.:.:..|...|.:.|.|..:...|......||
plant    88 ERTFIAIKPDGVQRGLISEIITRFERKGYKLVGIKVMVPSKGFAQKHYHDLKERPFFNGLCNFLS 152

  Fly    66 KGVSEAFIVTKENAVQ 81
            .|...|.:...|..::
plant   153 SGPVVAMVWEGEGVIR 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15547NP_651833.1 NDPk 3..119 CDD:469726 17/81 (21%)
AT4G23900NP_567690.1 PLN02619 1..237 CDD:178228 17/81 (21%)

Return to query results.
Submit another query.