powered by:
Protein Alignment CG15547 and Nme3
DIOPT Version :9
Sequence 1: | NP_651833.1 |
Gene: | CG15547 / 43661 |
FlyBaseID: | FBgn0039809 |
Length: | 390 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_062704.2 |
Gene: | Nme3 / 79059 |
MGIID: | 1930182 |
Length: | 169 |
Species: | Mus musculus |
Alignment Length: | 73 |
Identity: | 15/73 - (20%) |
Similarity: | 33/73 - (45%) |
Gaps: | 2/73 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 ENSLFIIKPDYLHKR--RPVLLKLLAEGFQIQGNRRIAFSPETAAEFYADYADEKGFMLEVILLS 65
|.:...:|||.:.:| ..::.:...:||::...:.:..|.|...|.|.:..::..:...|..:|
Mouse 22 ERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYVELREKPFYSRLVKYMS 86
Fly 66 KGVSEAFI 73
.|...|.:
Mouse 87 SGPVVAMV 94
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0105 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.