DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15547 and Nme8

DIOPT Version :9

Sequence 1:NP_651833.1 Gene:CG15547 / 43661 FlyBaseID:FBgn0039809 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_853622.2 Gene:Nme8 / 73412 MGIID:1920662 Length:586 Species:Mus musculus


Alignment Length:206 Identity:49/206 - (23%)
Similarity:80/206 - (38%) Gaps:49/206 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SLFIIKPD--YLHKRRPVLLKLLAEGFQIQGNRRIAFSPETAAEFYADYADEKGFMLEVILLSKG 67
            ::.|||||  .:.|...|..|:..|||.|:....:....|...|||...||:..|...|:.::.|
Mouse   156 NMAIIKPDAVLMRKNIEVREKIAKEGFVIEIQENLILPEEVVREFYTHIADQPDFEEFVVSMTNG 220

  Fly    68 VSEAFIVTKENA---VQELLNIMICYFGSASDLERNIHVTKNSYSVAREINFIFPNYIHEPHQMF 129
            :|...||::|::   .:|.|        ..:|.|..                  |..:.|||..|
Mouse   221 LSCVLIVSQEDSEVIQEETL--------PQTDTEEE------------------PGVLEEPHVRF 259

  Fly   130 DHNNFCNRPML----KPLLEEIYDIMQNTD-CSQENWKVRVSDYLVRSNPKMPEISNQCQQ---- 185
                   .|::    :..|:|..|....:| |..|:..|:||..:....|....:.:...|    
Mouse   260 -------APVMIKKKRDSLQEYMDRQHMSDYCDVEDDAVKVSKLIDILFPDFKTMKSTNVQTTLA 317

  Fly   186 --RPDVAIQDK 194
              .||:..::|
Mouse   318 LLHPDICEEEK 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15547NP_651833.1 NDK 3..120 CDD:197791 29/119 (24%)
NDPk 3..119 CDD:260363 29/118 (25%)
Nme8NP_853622.2 TRX_NDPK 11..113 CDD:239246
NDPk 155..301 CDD:260363 44/177 (25%)
NDK 1 157..254 30/122 (25%)
NDK 2 312..452 4/17 (24%)
NDK 313..450 CDD:197791 4/16 (25%)
NDPk_TX 313..445 CDD:239879 4/16 (25%)
NDK 448..581 CDD:197791
NDPk 448..579 CDD:260363
NDK 3 453..586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.