Sequence 1: | NP_651833.1 | Gene: | CG15547 / 43661 | FlyBaseID: | FBgn0039809 | Length: | 390 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_853622.2 | Gene: | Nme8 / 73412 | MGIID: | 1920662 | Length: | 586 | Species: | Mus musculus |
Alignment Length: | 206 | Identity: | 49/206 - (23%) |
---|---|---|---|
Similarity: | 80/206 - (38%) | Gaps: | 49/206 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 SLFIIKPD--YLHKRRPVLLKLLAEGFQIQGNRRIAFSPETAAEFYADYADEKGFMLEVILLSKG 67
Fly 68 VSEAFIVTKENA---VQELLNIMICYFGSASDLERNIHVTKNSYSVAREINFIFPNYIHEPHQMF 129
Fly 130 DHNNFCNRPML----KPLLEEIYDIMQNTD-CSQENWKVRVSDYLVRSNPKMPEISNQCQQ---- 185
Fly 186 --RPDVAIQDK 194 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15547 | NP_651833.1 | NDK | 3..120 | CDD:197791 | 29/119 (24%) |
NDPk | 3..119 | CDD:260363 | 29/118 (25%) | ||
Nme8 | NP_853622.2 | TRX_NDPK | 11..113 | CDD:239246 | |
NDPk | 155..301 | CDD:260363 | 44/177 (25%) | ||
NDK 1 | 157..254 | 30/122 (25%) | |||
NDK 2 | 312..452 | 4/17 (24%) | |||
NDK | 313..450 | CDD:197791 | 4/16 (25%) | ||
NDPk_TX | 313..445 | CDD:239879 | 4/16 (25%) | ||
NDK | 448..581 | CDD:197791 | |||
NDPk | 448..579 | CDD:260363 | |||
NDK 3 | 453..586 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0105 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
2 | 1.860 |