DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15547 and Nme5

DIOPT Version :9

Sequence 1:NP_651833.1 Gene:CG15547 / 43661 FlyBaseID:FBgn0039809 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_003751808.1 Gene:Nme5 / 688903 RGDID:1583004 Length:211 Species:Rattus norvegicus


Alignment Length:204 Identity:56/204 - (27%)
Similarity:92/204 - (45%) Gaps:37/204 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ENSLFIIKPDYLHKRRPVLLKLLAEGFQIQGNRRIAFSPETAAEFYADYADEKGFMLEVILLSKG 67
            |.:|.:||||.:.|...:...:|..||.|...|::..|||..:.||.:...:..|......:|.|
  Rat    13 EKTLALIKPDIVDKEEEIRDIILRSGFTIIQRRKLHLSPEHCSNFYVEQYGKMFFPNLTAYMSSG 77

  Fly    68 VSEAFIVTKENAV---QELL---NIMI----------CYFGSASDLERNIHVTKNSYSVAREINF 116
            ...|.|:.:.||:   :|||   |.::          ..:|: .:|...:|.:.:..:..|||.|
  Rat    78 PLVAMILARHNAISYWKELLGPANSLLAKETHPDSLRAIYGT-DELRNALHGSNDFAASEREIRF 141

  Fly   117 IFPNYIHEP----HQMFDHNNFCNRPMLKPLLEEIYDIMQNTDCSQEN-----WKVRVSDYLVRS 172
            :||..|.||    ....|:.|....|.|...|.|:        |.|:.     |   ::|:||::
  Rat   142 MFPEVIIEPIPIGQAAKDYLNLYVAPTLLQGLTEL--------CKQKPADPYIW---LADWLVKN 195

  Fly   173 NPKMPEISN 181
            ||..|::|:
  Rat   196 NPNKPKLSH 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15547NP_651833.1 NDK 3..120 CDD:197791 36/132 (27%)
NDPk 3..119 CDD:260363 35/131 (27%)
Nme5XP_003751808.1 NDPk5 13..144 CDD:239880 35/131 (27%)
Dpy-30 156..197 CDD:398726 12/51 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353296
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105512
Panther 1 1.100 - - LDO PTHR46161
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.