DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15547 and Nme4

DIOPT Version :9

Sequence 1:NP_651833.1 Gene:CG15547 / 43661 FlyBaseID:FBgn0039809 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001102948.1 Gene:Nme4 / 685679 RGDID:1591334 Length:185 Species:Rattus norvegicus


Alignment Length:134 Identity:31/134 - (23%)
Similarity:52/134 - (38%) Gaps:22/134 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ENSLFIIKPDYLHKR--RPVLLKLLAEGFQIQGNRRIAFSPETAAEFYADYADEKGFMLEVILLS 65
            |.:|..:|||.:.:|  ..|:.:....||::.|.:.:.......||.|.|...:..:...:..:|
  Rat    36 ERTLVAVKPDGVQRRLVGTVIHRFERRGFKLVGMKMLQAPESILAEHYRDLQRKPFYPALISYMS 100

  Fly    66 KGVSEAFIVTKENAVQELLNIMICYFGSASDLER---------NIHVTKN----SYSV---AREI 114
            .|...|.:....|.|    :|.....|.....|.         ::|:::|    |.||   .|||
  Rat   101 SGPVVAMVWEGHNVV----HISRAMIGHTDSTEAAPGTIRGDFSVHISRNVIHASDSVDGAQREI 161

  Fly   115 NFIF 118
            ...|
  Rat   162 ELWF 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15547NP_651833.1 NDK 3..120 CDD:197791 31/134 (23%)
NDPk 3..119 CDD:260363 31/134 (23%)
Nme4NP_001102948.1 NDPk_I 36..165 CDD:239876 30/132 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.