DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15547 and nme6

DIOPT Version :9

Sequence 1:NP_651833.1 Gene:CG15547 / 43661 FlyBaseID:FBgn0039809 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_571672.2 Gene:nme6 / 58120 ZFINID:ZDB-GENE-000710-3 Length:175 Species:Danio rerio


Alignment Length:156 Identity:38/156 - (24%)
Similarity:64/156 - (41%) Gaps:28/156 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SLFIIKPDYLHKRRPVLLKLL----AEGFQIQGNRRIAFSPETAAEFYADYADEKGFMLEVILLS 65
            :|.:||||.:  ..|::|:.|    .|.|.|...:.:.:....:..|||:::....|...|..:|
Zfish    10 TLAVIKPDAM--AHPLILEALHQKILENFIIIRKKDLIWRKADSEMFYAEHSGRFFFQRLVEFMS 72

  Fly    66 KGVSEAFIVTKENAVQELLNIM------ICYFGS---------ASDLERNIHVTKNSYSVAREIN 115
            .|...|:|:.:|:|:.....:|      ...|.|         .:|.....|.:.:..|..|||:
Zfish    73 SGPMRAYILAREDAITHWRTMMGPTKVFRARFSSPETLRGKYGLTDTRNTTHGSDSIESAKREIS 137

  Fly   116 FIFPNYI-------HEPHQMFDHNNF 134
            |.||.:.       .|||....|..:
Zfish   138 FFFPEFSAEEWMMREEPHFRLGHTEY 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15547NP_651833.1 NDK 3..120 CDD:197791 33/133 (25%)
NDPk 3..119 CDD:260363 32/132 (24%)
nme6NP_571672.2 NDK 8..144 CDD:197791 34/135 (25%)
NDPk6 8..141 CDD:239877 32/132 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.