DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG15547 and NME8

DIOPT Version :9

Sequence 1:	NP_651833.1	Gene:	CG15547 / 43661	FlyBaseID:	FBgn0039809	Length:	390	Species:	Drosophila melanogaster
Sequence 2:	NP_057700.3	Gene:	NME8 / 51314	HGNCID:	16473	Length:	588	Species:	Homo sapiens

Alignment Length:	142	Identity:	39/142 - (27%)
Similarity:	63/142 - (44%)	Gaps:	36/142 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly     3 ENSLFIIKPDYLHKRRPVLLKLLAE-GFQIQGNRRIAFSPE---------TAAEFYADYADEKGF 57
            :::|.:|||....::|..:||::.| ||.:...:::..:||         |..:||.|
Human   451 QSTLGLIKPHATSEQREQILKIVKEAGFDLTQVKKMFLTPEQIEKIYPKVTGKDFYKD------- 508

  Fly    58 MLEVILLSKGVSEAFIVTKENAVQELLNIM----------------ICYFGSASDLERNIHVTKN 106
            :||  :||.|.|...|:||.|||.|...:|                ...|| .|.|:..:|...|
Human   509 LLE--MLSVGPSMVMILTKWNAVAEWRRLMGPTDPEEAKLLSPDSIRAQFG-ISKLKNIVHGASN 570

  Fly   107 SYSVAREINFIF 118
            :|.....:|.:|
Human   571 AYEAKEVVNRLF 582

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG15547	NP_651833.1	NDK	3..120	CDD:197791	39/142 (27%)
CG15547	NP_651833.1	NDPk	3..119	CDD:260363	39/142 (27%)
NME8	NP_057700.3	TRX_NDPK	11..113	CDD:239246
		NDPk_TX	154..304	CDD:239879
		NDK 1	157..257
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	230..261
		NDK 2	315..455		0/3 (0%)
		NDK	316..453	CDD:197791	0/1 (0%)
		NDPk_TX	316..448	CDD:239879
		NDK	451..586	CDD:197791	39/142 (27%)
		NDPk_TX	451..582	CDD:239879	38/140 (27%)
		NDK 3	456..588		38/137 (28%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0105
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	1	0.960	-	-
User_Submission	0	0.000	Not matched by this tool.
	3	2.770