DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15547 and NME4

DIOPT Version :9

Sequence 1:NP_651833.1 Gene:CG15547 / 43661 FlyBaseID:FBgn0039809 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_005000.1 Gene:NME4 / 4833 HGNCID:7852 Length:187 Species:Homo sapiens


Alignment Length:131 Identity:31/131 - (23%)
Similarity:50/131 - (38%) Gaps:16/131 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ENSLFIIKPDYLHKR--RPVLLKLLAEGFQIQGNRRIAFSPETAAEFYADYADEKGFMLEVILLS 65
            |.:|..:|||.:.:|  ..|:.:....||.:.|.:.:.......||.|.|...:..:...:..:|
Human    38 ERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMS 102

  Fly    66 KGVSEAFIVTKENAVQELLNIMICYFGSAS------------DLERN-IHVTKNSYSVAREINFI 117
            .|...|.:....|.|: ....||.:..||.            .:.|| ||.:.:.....|||...
Human   103 SGPVVAMVWEGYNVVR-ASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLW 166

  Fly   118 F 118
            |
Human   167 F 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15547NP_651833.1 NDK 3..120 CDD:197791 31/131 (24%)
NDPk 3..119 CDD:260363 31/131 (24%)
NME4NP_005000.1 NDK 38..172 CDD:197791 31/131 (24%)
NDPk_I 38..167 CDD:239876 30/129 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.