DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15547 and NME1

DIOPT Version :9

Sequence 1:NP_651833.1 Gene:CG15547 / 43661 FlyBaseID:FBgn0039809 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_937818.1 Gene:NME1 / 4830 HGNCID:7849 Length:177 Species:Homo sapiens


Alignment Length:182 Identity:37/182 - (20%)
Similarity:59/182 - (32%) Gaps:60/182 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ENSLFIIKPDYLHKR--RPVLLKLLAEGFQIQGNRRIAFSPETAAEFYADYADEKGFMLEVILLS 65
            |.:...||||.:.:.  ..::.:...:||::.|.:.:..|.:...|.|.|..|...|...|..:.
Human    30 ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQASEDLLKEHYVDLKDRPFFAGLVKYMH 94

  Fly    66 KG-----VSEAFIVTKENAVQELLNIMICYFGSASDLE---------------RN-IHVTKNSYS 109
            .|     |.|...|.|...|.         .|..:..:               || ||.:.:..|
Human    95 SGPVVAMVWEGLNVVKTGRVM---------LGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVES 150

  Fly   110 VAREINFIFPNYIHEPHQMFDHNNFCNRPMLKPLLEEIYDIMQNTDCSQENW 161
            ..:||...|     .|.::.|:                      |.|:| ||
Human   151 AEKEIGLWF-----HPEELVDY----------------------TSCAQ-NW 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15547NP_651833.1 NDK 3..120 CDD:197791 30/139 (22%)
NDPk 3..119 CDD:260363 29/138 (21%)
NME1NP_937818.1 PTZ00093 30..176 CDD:173387 37/182 (20%)
NDK 30..164 CDD:278749 31/147 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.