DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15547 and nme5

DIOPT Version :9

Sequence 1:NP_651833.1 Gene:CG15547 / 43661 FlyBaseID:FBgn0039809 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001002516.1 Gene:nme5 / 436789 ZFINID:ZDB-GENE-040718-221 Length:217 Species:Danio rerio


Alignment Length:196 Identity:52/196 - (26%)
Similarity:93/196 - (47%) Gaps:21/196 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ENSLFIIKPDYLHKRRPVLLKLLAEGFQIQGNRRIAFSPETAAEFYADYADEKGFMLEVILLSKG 67
            |.:|.:||||.:||...:...:|..||.|...||:..|||..::|||::..:..|......:|.|
Zfish    18 ERTLALIKPDAIHKTDEIEDIILQSGFTILQKRRLQLSPEQCSDFYAEHYGKLHFPHLTAFMSSG 82

  Fly    68 VSEAFIVTKENAVQELLNIM-------------ICY---FGSASDLERNIHVTKNSYSVAREINF 116
            ...|..:.::.|:.....||             .|.   ||:. ||...:|.::...:..|||.|
Zfish    83 PVVALALARDQAIATWKAIMGPVSSIKARETHPDCLRARFGTC-DLRNAVHGSETFSAAEREIRF 146

  Fly   117 IFPNYIHEPHQMFD-HNNFCNRPMLKPLLEEIYDIMQNTDCSQENWKVRVSDYLVRSNPKMPEIS 180
            :||:.:.||..|.: ..::.:|.:...||..:.::.:........|   ::|:|:.:||..|::|
Zfish   147 MFPHSVIEPIPMGEAAKDYLSRFINPTLLVGLTELCKIKPEDPYTW---LADWLMNNNPNKPKVS 208

  Fly   181 N 181
            :
Zfish   209 D 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15547NP_651833.1 NDK 3..120 CDD:197791 38/132 (29%)
NDPk 3..119 CDD:260363 37/131 (28%)
nme5NP_001002516.1 NDK 18..153 CDD:278749 39/135 (29%)
NDPk5 18..149 CDD:239880 37/131 (28%)
Dpy-30 161..202 CDD:253069 6/43 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595400
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105512
Panther 1 1.100 - - LDO PTHR46161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.