DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15547 and nmdyn-D6

DIOPT Version :9

Sequence 1:NP_651833.1 Gene:CG15547 / 43661 FlyBaseID:FBgn0039809 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_572965.1 Gene:nmdyn-D6 / 32396 FlyBaseID:FBgn0030573 Length:151 Species:Drosophila melanogaster


Alignment Length:137 Identity:32/137 - (23%)
Similarity:59/137 - (43%) Gaps:19/137 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ENSLFIIKPDYLHKRRPV--LLKLLAEGFQIQGNRRIAFSPETAAEFYADYADEKGFMLEVILLS 65
            |.:|.:|||..|.....:  :..|:::.|.|...:.:..:.|.:..|||::..:..:......::
  Fly     2 EITLALIKPHVLRNTYAMQQIRALISQNFTILDQKEVCITKELSERFYAEHKGKFFYHRLTSFMN 66

  Fly    66 KGVSEAFIVTKENAVQE---LL-------------NIMICYFGSASDLERNIHVTKNSYSVAREI 114
            .|.|.|.|:..|..:|:   ||             |.:...:| .||.....|.:.:..|..|||
  Fly    67 SGPSYALILQSETCIQKWRSLLGPTKVFRAVYSDPNCIRALYG-ISDTRNACHGSDSEASALREI 130

  Fly   115 NFIFPNY 121
            :.:||.:
  Fly   131 SILFPEF 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15547NP_651833.1 NDK 3..120 CDD:197791 31/134 (23%)
NDPk 3..119 CDD:260363 30/133 (23%)
nmdyn-D6NP_572965.1 NDK 2..138 CDD:197791 32/137 (23%)
NDPk6 2..135 CDD:239877 30/133 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465018
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0105
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46161
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.