DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15547 and nme7

DIOPT Version :9

Sequence 1:NP_651833.1 Gene:CG15547 / 43661 FlyBaseID:FBgn0039809 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_571004.2 Gene:nme7 / 30086 ZFINID:ZDB-GENE-000210-35 Length:374 Species:Danio rerio


Alignment Length:269 Identity:55/269 - (20%)
Similarity:101/269 - (37%) Gaps:59/269 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ENSLFIIKPDYLHKRRPVLLKLLAEGFQIQGNRRIAFSPETAAEFYADYADEKGFMLEVILLSKG 67
            |.:|.:||||.:.|...::..:......:...:....:.:.||:||.::..:..|...|..:|.|
Zfish    90 ERTLAMIKPDAVSKVGDIIQMIYDANLIVTKAKMTKLTWKQAADFYMEHQSKSFFNNLVQFVSSG 154

  Fly    68 VSEAFIVTKENAV----------------QELLNIMICYFGSASDLERNI-HVTKNSYSVAREIN 115
            ...|..:..:.||                :|..:.:...||  :|..:|. |.:.:..|.|||:.
Zfish   155 PVIAMELMGDEAVSTWRKVLGPTDSGVAQKEAAHSLRGQFG--TDGTKNAGHGSDSLASAARELE 217

  Fly   116 FIFPN-----------------YIHEPHQMFDHNNFCNRPMLKPLLEEIYDI----MQNTDCSQE 159
            :.||:                 .|.:||.:   :......:||.::|..::|    |.|.|.:..
Zfish   218 YFFPSTAGHGLSNTAKYSDCTCCIIKPHAI---SEALTGKILKSIIENGFEISALQMFNMDRANA 279

  Fly   160 NWKVRVSDYLVRSNPKMPEISNQCQQRPDVAIQDKSQQTTMTY------APKPSARAAQP----- 213
            ...:.|...:|....||  :...| ..|.:|::..:.....|:      |....||..:|     
Zfish   280 EEFLEVYKGVVAEYTKM--VDELC-SGPCMALEIHATDAPRTFREFCGPADPEIARHLRPKTLRA 341

  Fly   214 --GVKKTQS 220
              |..|.|:
Zfish   342 LYGKNKLQN 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15547NP_651833.1 NDK 3..120 CDD:197791 29/133 (22%)
NDPk 3..119 CDD:260363 28/132 (21%)
nme7NP_571004.2 DM10 1..89 CDD:128921
NDPk7A 90..220 CDD:239878 28/131 (21%)
NDPk7B 236..369 CDD:239875 25/121 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.