DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15547 and NME7

DIOPT Version :9

Sequence 1:NP_651833.1 Gene:CG15547 / 43661 FlyBaseID:FBgn0039809 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_037462.1 Gene:NME7 / 29922 HGNCID:20461 Length:376 Species:Homo sapiens


Alignment Length:302 Identity:60/302 - (19%)
Similarity:106/302 - (35%) Gaps:97/302 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ENSLFIIKPDYLHKRRPVLLKLLAEGFQIQGNRRIAFSPETAAEFYADYADEKGFMLEVILLSKG 67
            |.:|.:||||.:.|...::..:...||.|...:.:..|.:.|.:|:.|:.....|...:..::.|
Human    92 EKTLALIKPDAISKAGEIIEIINKAGFTITKLKMMMLSRKEALDFHVDHQSRPFFNELIQFITTG 156

  Fly    68 VSEAFIVTKENAVQELLNIM----------------ICYFGSASDLERN-IHVTKNSYSVAREIN 115
            ...|..:.:::|:.|...::                ...||  :|..|| .|...:..|.|||:.
Human   157 PIIAMEILRDDAICEWKRLLGPANSGVARTDASESIRALFG--TDGIRNAAHGPDSFASAAREME 219

  Fly   116 FIFPN-----------------YIHEPH------------------------QMFDHNNFCNRPM 139
            ..||:                 .|.:||                        |||:        |
Human   220 LFFPSSGGCGPANTAKFTNCTCCIVKPHAVSEGLLGKILMAIRDAGFEISAMQMFN--------M 276

  Fly   140 LKPLLEEIYDIMQNTDCSQENWKVRVSDYLVRSNPKMPEISNQCQQRPDVAIQDKSQQTTMTY-- 202
            .:..:||.|::          :|..|::|        .::..:....|.||::.:....|.|:  
Human   277 DRVNVEEFYEV----------YKGVVTEY--------HDMVTEMYSGPCVAMEIQQNNATKTFRE 323

  Fly   203 ----APKPSARAAQPGV-----KKTQSSSAPLSTTSPHSSML 235
                |....||..:||.     .||:..:|...|..|...:|
Human   324 FCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDLPEDGLL 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15547NP_651833.1 NDK 3..120 CDD:197791 30/133 (23%)
NDPk 3..119 CDD:260363 29/132 (22%)
NME7NP_037462.1 DM10 3..91 CDD:128921
NDPk7A 92..222 CDD:239878 29/131 (22%)
NDPk7B 238..371 CDD:239875 29/154 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.