DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15547 and Nme7

DIOPT Version :9

Sequence 1:NP_651833.1 Gene:CG15547 / 43661 FlyBaseID:FBgn0039809 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_036018403.1 Gene:Nme7 / 171567 MGIID:2449121 Length:408 Species:Mus musculus


Alignment Length:292 Identity:68/292 - (23%)
Similarity:111/292 - (38%) Gaps:77/292 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ENSLFIIKPDYLHKRRPVLLKLLAEGFQIQGNRRIAFSPETAAEFYADYADEKGFMLEVI-LLSK 66
            |.:|.:||||.:.|...::..:...||.|...|.:..:.:.||:|:.|: ..:.|..|:| .::.
Mouse   124 EKTLALIKPDAVSKAGEIIEMINKSGFTITKLRMMTLTRKEAADFHVDH-HSRPFYNELIQFITS 187

  Fly    67 GVSEAFIVTKENAVQELLNIM----------------ICYFGSASDLERN-IHVTKNSYSVAREI 114
            |...|..:.:::|:.|...::                ...||  :|..|| .|......|.|||:
Mouse   188 GPVIAMEILRDDAICEWKRLLGPANSGLSRTDAPGSIRALFG--TDGVRNAAHGPDTFASAAREM 250

  Fly   115 NFIFPN-----------------YIHEPHQMFDHNNFCNRPMLKPLLEEIYDI--------MQNT 154
            ...||:                 .|.:||.:       :..||..:|..|.|.        |.|.
Mouse   251 ELFFPSSGGCGPANTAKFTNCTCCIIKPHAI-------SEGMLGKILIAIRDACFGMSAIQMFNL 308

  Fly   155 DCSQ-----ENWKVRVSDYLVRSNPKMPEISNQCQQRPDVAIQDKSQQTTMTY------APKPSA 208
            |.:.     |.:|..||:|    |..:.|:.:    .|.|||:.:....|.|:      |....|
Mouse   309 DRANVEEFYEVYKGVVSEY----NDMVTELCS----GPCVAIEIQQSNPTKTFREFCGPADPEIA 365

  Fly   209 RAAQPGV-----KKTQSSSAPLSTTSPHSSML 235
            |..:|..     .||:..:|...|..|...:|
Mouse   366 RHLRPETLRAIFGKTKVQNAVHCTDLPEDGLL 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15547NP_651833.1 NDK 3..120 CDD:197791 33/134 (25%)
NDPk 3..119 CDD:260363 32/133 (24%)
Nme7XP_036018403.1 DM10 35..123 CDD:128921
NDPk7A 124..254 CDD:239878 32/132 (24%)
NDPk7B 270..403 CDD:239875 34/143 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.