DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15547 and awd

DIOPT Version :10

Sequence 1:NP_651833.1 Gene:CG15547 / 43661 FlyBaseID:FBgn0039809 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_308641.4 Gene:awd / 1269986 VectorBaseID:AGAMI1_003206 Length:168 Species:Anopheles gambiae


Alignment Length:81 Identity:20/81 - (24%)
Similarity:37/81 - (45%) Gaps:2/81 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ENSLFIIKPDYLHKR--RPVLLKLLAEGFQIQGNRRIAFSPETAAEFYADYADEKGFMLEVILLS 65
            |.:..:||||.:.:.  ..::.:..|:||::...:.:..|.|...:.|||.:....|...|..:|
Mosquito    21 ERTFIMIKPDGVQRGLVGQIMQRFEAKGFKLVAMKFMWPSKELLEKHYADLSARPFFPGLVTYMS 85

  Fly    66 KGVSEAFIVTKENAVQ 81
            .|.....:....|||:
Mosquito    86 SGPVVPMVWEGLNAVK 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15547NP_651833.1 NDPk 3..119 CDD:469726 20/81 (25%)
awdXP_308641.4 PTZ00093 19..167 CDD:173387 20/81 (25%)

Return to query results.
Submit another query.