DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15547 and NME6

DIOPT Version :9

Sequence 1:NP_651833.1 Gene:CG15547 / 43661 FlyBaseID:FBgn0039809 Length:390 Species:Drosophila melanogaster
Sequence 2:XP_024309066.1 Gene:NME6 / 10201 HGNCID:20567 Length:336 Species:Homo sapiens


Alignment Length:82 Identity:22/82 - (26%)
Similarity:33/82 - (40%) Gaps:14/82 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 PDVAI-QDKSQQTTMTYAPKPSARAAQPGVKKTQSSSAPLST-TSPHSSMLLSSSSCVTCGGFER 249
            |.||: |..:|.:....||:|::..||.|.:    .:.|.|. ..|.....|..|:...|....|
Human    44 PCVALRQHPAQHSLPPRAPRPASEGAQAGFR----GAVPTSEFRRPERLHPLVPSAANACAWKTR 104

  Fly   250 SQPGISDLDLNKRVEPH 266
            ..||        ::.||
Human   105 HPPG--------QLTPH 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15547NP_651833.1 NDK 3..120 CDD:197791
NDPk 3..119 CDD:260363
NME6XP_024309066.1 DNA_pol3_gamma3 <24..>132 CDD:331207 22/82 (27%)
NDPk <155..209 CDD:320914
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.