DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15547 and nme6

DIOPT Version :9

Sequence 1:NP_651833.1 Gene:CG15547 / 43661 FlyBaseID:FBgn0039809 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_001123709.1 Gene:nme6 / 100170458 XenbaseID:XB-GENE-969918 Length:179 Species:Xenopus tropicalis


Alignment Length:137 Identity:35/137 - (25%)
Similarity:59/137 - (43%) Gaps:22/137 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SLFIIKPDYLHKRRPVL-----LKLLAEGFQIQGNRRIAFSPETAAEFYADYADEKGFMLEVILL 64
            :|.:||||.:  ..||:     .|:|...|.|..::.:.:....:..||.::.....:...|..:
 Frog    13 TLALIKPDAV--ANPVISEAVHQKILENNFLIIRHKELHWRSTDSQRFYCEHKGRFFYQRLVEFM 75

  Fly    65 SKGVSEAFIVTKENAVQELLNIM---------ICYFGSA------SDLERNIHVTKNSYSVAREI 114
            |.|..:|:|:..|:|||...|:|         |...|:.      :|.....|.:.:..|..|||
 Frog    76 SSGPMQAYILAHEDAVQLWRNLMGPTKVFRARIVAPGTVRGDLGLTDTRNTTHGSDSVESACREI 140

  Fly   115 NFIFPNY 121
            .|.||.:
 Frog   141 TFFFPEF 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15547NP_651833.1 NDK 3..120 CDD:197791 34/134 (25%)
NDPk 3..119 CDD:260363 33/133 (25%)
nme6NP_001123709.1 NDPk6 11..145 CDD:239877 33/133 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.