DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12071 and ADR1

DIOPT Version :9

Sequence 1:NP_651832.3 Gene:CG12071 / 43660 FlyBaseID:FBgn0039808 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_010502.3 Gene:ADR1 / 851802 SGDID:S000002624 Length:1323 Species:Saccharomyces cerevisiae


Alignment Length:508 Identity:88/508 - (17%)
Similarity:159/508 - (31%) Gaps:189/508 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 KALQQVQQASSGVRKTNPSKSTN-KAFECTVCGKGLARKDKLTIHMRIHTGEKPYICEVCNKAFA 223
            |..:|:.:....:|....:.|.. ::|.|.||.:..||::.|..|.|.||.||||.|.:||:.|.
Yeast    78 KINKQLDKLPENLRLNGRTPSGKLRSFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFT 142

  Fly   224 RRDKLVIHMNKF------------------------------KHVTPTNIAP-LGKRLNNMVKKK 257
            |||.|:.|..|.                              |..|||...| .|..||......
Yeast   143 RRDLLIRHAQKIHSGNLGETISHTKKVSRTITKARKNSASSVKFQTPTYGTPDNGNFLNRTTANT 207

  Fly   258 EQPDPPPEDNKQSLELQLQQQAVQVAAQNIIVQSAQGAPTSIPGIIIPHHQQQLSWTCELCGRMF 322
            .:...|..:.|:....:|.::|         ..|||.|.:                        :
Yeast   208 RRKASPEANVKRKYLKKLTRRA---------SFSAQSASS------------------------Y 239

  Fly   323 SSRDEWSI--HAKSHLEYXQPERLVAESTKPAAAAAG------------------VIAKTTSSNN 367
            :..|:.|:  |.|..:::..||.:..:...|...::.                  .:.::.||.:
Yeast   240 ALPDQSSLEQHPKDRVKFSTPELVPLDLKNPELDSSFDLNMNLDLNLNLDSNFNIALNRSDSSGS 304

  Fly   368 SRN--YQMDANQNQIQMEAQARKQKIIIQNQMILNASHQQQQQPQQHPQQQQHQQQQQQHVAHGK 430
            :.|  |::..:.|.....:.:..:..:..|....|||.....                  :....
Yeast   305 TMNLDYKLPESANNYTYSSGSPTRAYVGANTNSKNASFNDAD------------------LLSSS 351

  Fly   431 KAARKHQQHLQQQQQQQQQQQQQQQQQQQQTSAPMY-------------------NNNSSSNHNG 476
            ...:.:..||....:..:......:....:...|.:                   :|||::|...
Yeast   352 YWIKAYNDHLFSVSESDETSPMNSELNDTKLIVPDFKSTIHHLKDSRSSSWTVAIDNNSNNNKVS 416

  Fly   477 NNQS-----QEV-----------------------------------SVPVSHI-IANSPTA--- 497
            :||.     ||:                                   .:.:||: ::|||.:   
Yeast   417 DNQPDFVDFQELLDNDTLGNDLLETTAVLKEFELLHDDSVSATATSNEIDLSHLNLSNSPISPHK 481

  Fly   498 -------ATYMQAQLS---EHASNMQHGMPIVTYNGNQYCVITRAPDLDVEAM 540
                   .|.....:|   :|.||.:..:       ::.|.:||    ||:|:
Yeast   482 LIYKNKEGTNDDMLISFGLDHPSNREDDL-------DKLCNMTR----DVQAI 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12071NP_651832.3 zf-C2H2 185..207 CDD:278523 9/21 (43%)
C2H2 Zn finger 187..207 CDD:275368 8/19 (42%)
zf-H2C2_2 200..224 CDD:290200 13/23 (57%)
C2H2 Zn finger 215..232 CDD:275368 8/16 (50%)
ADR1NP_010502.3 zf-C2H2 104..126 CDD:395048 9/21 (43%)
C2H2 Zn finger 106..126 CDD:275368 8/19 (42%)
zf-H2C2_2 118..143 CDD:404364 13/24 (54%)
C2H2 Zn finger 134..155 CDD:275368 10/20 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.