DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12071 and AT5G60470

DIOPT Version :9

Sequence 1:NP_651832.3 Gene:CG12071 / 43660 FlyBaseID:FBgn0039808 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001331895.1 Gene:AT5G60470 / 836168 AraportID:AT5G60470 Length:459 Species:Arabidopsis thaliana


Alignment Length:467 Identity:95/467 - (20%)
Similarity:147/467 - (31%) Gaps:147/467 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 EQLTYNIPKPNLIPFTEPYVEGGSMHPASRLKALQQVQQASSGVRKTNPSKSTNKAFECTVCGKG 193
            |.:|.| |.||             ..||:..|..::        ::..|......|...::..|.
plant    24 EHITPN-PYPN-------------SQPAASTKTPKK--------KRNLPGNPDPNAEVISLSPKS 66

  Fly   194 LARKDKLTIHMRIHTGEKPYICEVCNKAFARRDKLVIHMNKFKHVTPTNIAPLGKRLNNMVKKKE 258
            |...::             :.||:|||.|.|...|.:|  |..|..|..:..  |...|.|||| 
plant    67 LMATNR-------------FFCEICNKGFQREQNLQLH--KRGHNLPWKLKQ--KTNKNQVKKK- 113

  Fly   259 QPDPPPEDNKQSLELQLQQQAVQVAAQNIIVQ----SAQGAPTSIPGIIIPHHQQQLSWTCELCG 319
                                 |.:..:...|.    .|.|..|.|.......|.:: .|.|:.|.
plant   114 ---------------------VYICPEKSCVHHDPARALGDLTGIKKHFSRKHGEK-KWKCDKCS 156

  Fly   320 RMFSSRDEWSIHAK----------------------SHLEYXQPERLVAESTK----PAAAAA-G 357
            :.::...:|..|.|                      ||..:.  :.|..||:|    |:..|| .
plant   157 KKYAVISDWKAHNKICGSREFRCDCGTLFSRKDSFISHRSFC--DVLAEESSKFFSVPSPLAANS 219

  Fly   358 VIAKTTSSNNSRNYQMDANQNQI-QMEAQARKQKIIIQNQMILNASHQQQQQPQQHPQQQQHQQQ 421
            .||..|.:||....|...:|:.. ..:.........:..|...| |:..||||...........:
plant   220 TIATVTDTNNPILIQSQLDQSSTGTADLNVNNNHTTLFGQKFTN-SNPTQQQPNALALSSPPSPR 283

  Fly   422 QQQHVAHGKKAARKHQQHLQQQQQQQQQQQQQQQQQQQQTSAPMYNNNSSSNHNGNNQSQEVSVP 486
            ......|          :|.:.|:::...|....:..        |||.:..|.|..::||..:.
plant   284 STSDSVH----------NLWKLQEEECAHQWLLNEYM--------NNNKNIFHKGIFKNQEDEIK 330

  Fly   487 VSHIIANS-PT---------------------AATYMQ--AQL-----SEHASNMQHGMPIVTYN 522
            ..:|.:.| ||                     |.|.:|  ||.     ||.::.|...|....:|
plant   331 KGNIYSGSNPTDGNIASLFSYNQEAVNMASFSATTLLQKVAQTGTPSSSETSTTMFGQMTSSIFN 395

  Fly   523 G---NQYCVITR 531
            .   |.||:..:
plant   396 NTMLNSYCLTAK 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12071NP_651832.3 zf-C2H2 185..207 CDD:278523 2/21 (10%)
C2H2 Zn finger 187..207 CDD:275368 2/19 (11%)
zf-H2C2_2 200..224 CDD:290200 6/23 (26%)
C2H2 Zn finger 215..232 CDD:275368 8/16 (50%)
AT5G60470NP_001331895.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2683
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.