DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12071 and NUC

DIOPT Version :9

Sequence 1:NP_651832.3 Gene:CG12071 / 43660 FlyBaseID:FBgn0039808 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_199229.1 Gene:NUC / 834439 AraportID:AT5G44160 Length:466 Species:Arabidopsis thaliana


Alignment Length:401 Identity:80/401 - (19%)
Similarity:134/401 - (33%) Gaps:101/401 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 VQQASSGVRKTNPSKSTNKAFECTVCGKGLARKDK------------LTIHMRIHTGEKPYICEV 217
            :|..|||.....|..|:....:.::....|.:|.:            :.:..........::|||
plant     6 LQTISSGSGFAQPQSSSTLDHDESLINPPLVKKKRNLPGNPDPEAEVIALSPTTLMATNRFLCEV 70

  Fly   218 CNKAFARRDKLVIHMNKFKHVTPTNIAPLGKRLNNMVKKKEQPDPPPEDNKQSLELQLQQQAVQV 282
            |.|.|.|...|.:|                :|.:|:..|.:|        :.|.|:   ::.|.|
plant    71 CGKGFQRDQNLQLH----------------RRGHNLPWKLKQ--------RTSKEV---RKRVYV 108

  Fly   283 AAQNIIV----QSAQGAPTSIPGIIIPHHQQQLSWTCELCGRMFSSRDEWSIHAK---------- 333
            ..:...|    ..|.|..|.|.......|.:: .||||.|.:.::.:.:|..|:|          
plant   109 CPEKTCVHHHSSRALGDLTGIKKHFCRKHGEK-KWTCEKCAKRYAVQSDWKAHSKTCGTREYRCD 172

  Fly   334 ------------SHLEYXQPERLVAESTKPAAAA--AGVIAKTTSSNNSRNYQMDANQNQIQMEA 384
                        :|..:.  :.|..|:.|..|.:  .|:.|.....:.:.|||      .:....
plant   173 CGTIFSRRDSFITHRAFC--DALAEETAKINAVSHLNGLAAAGAPGSVNLNYQ------YLMGTF 229

  Fly   385 QARKQKIIIQNQMILNASHQQQQQPQQH-----------PQQQQHQQQQQQHVAHGKKAARKHQQ 438
            ....|..:.|.|...|..||..|.|...           |.|   .|.....|....|||.....
plant   230 IPPLQPFVPQPQTNPNHHHQHFQPPTSSSLSLWMGQDIAPPQ---PQPDYDWVFGNAKAASACID 291

  Fly   439 HLQQQQQQQQQQQQQQQQQQQQTSAP-MYNN----NSSSNHNGNNQSQEVSVPVSHIIANSPTAA 498
            :.....:|..|............||| ::::    |:::|.|.|..:..:....:.|.|.|.|.|
plant   292 NNNTHDEQITQNANASLTTTTTLSAPSLFSSDQPQNANANSNVNMSATALLQKAAEIGATSTTTA 356

  Fly   499 ------TYMQA 503
                  |::|:
plant   357 ATNDPSTFLQS 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12071NP_651832.3 zf-C2H2 185..207 CDD:278523 2/33 (6%)
C2H2 Zn finger 187..207 CDD:275368 2/31 (6%)
zf-H2C2_2 200..224 CDD:290200 6/23 (26%)
C2H2 Zn finger 215..232 CDD:275368 8/16 (50%)
NUCNP_199229.1 C2H2 Zn finger 68..88 CDD:275368 10/35 (29%)
C2H2 Zn finger 109..137 CDD:275368 5/27 (19%)
C2H2 Zn finger 144..163 CDD:275368 5/18 (28%)
C2H2 Zn finger 171..187 CDD:275368 0/15 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2683
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.