DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12071 and AT3G45260

DIOPT Version :9

Sequence 1:NP_651832.3 Gene:CG12071 / 43660 FlyBaseID:FBgn0039808 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001327332.1 Gene:AT3G45260 / 823664 AraportID:AT3G45260 Length:446 Species:Arabidopsis thaliana


Alignment Length:456 Identity:79/456 - (17%)
Similarity:149/456 - (32%) Gaps:141/456 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 TYNIPKPNLIPFTEPYVEGGSMHPASRLKALQQVQQASSGVRKTNPSK--STNKAFECTVCGKGL 194
            :|.:.:.::.|...|.....|.:.|.|.:.|.......:.|...:|:.  :||:           
plant    14 SYVLHQEHIAPNPNPNPNPTSSNSAKRKRNLPGNPDPDAEVIALSPNSLMTTNR----------- 67

  Fly   195 ARKDKLTIHMRIHTGEKPYICEVCNKAFARRDKLVIHMNKFKHVTPTNIAPLGKRLNNMVKKKEQ 259
                              :|||||||.|.|...|.:|                :|.:|:..|.:|
plant    68 ------------------FICEVCNKGFKRDQNLQLH----------------RRGHNLPWKLKQ 98

  Fly   260 PDPPPEDNKQSLELQLQQQAVQVAAQNIIVQ----SAQGAPTSIPGIIIPHHQQQLSWTCELCGR 320
                 ..||:.:     ::.|.:..:...|.    .|.|..|.|.......|.:: .|.|:.|.:
plant    99 -----RTNKEQV-----KKKVYICPEKTCVHHDPARALGDLTGIKKHFSRKHGEK-KWKCDKCSK 152

  Fly   321 MFSSRDEWSIHAK----------------------SHLEY-----XQPERLVAESTKPAAAAAGV 358
            .::...:|..|:|                      :|..:     .:..|.|:....||.....:
plant   153 KYAVMSDWKAHSKICGTKEYRCDCGTLFSRKDSFITHRAFCDALAEESARFVSVPPAPAYLNNAL 217

  Fly   359 IAKTTSSNNSRNYQ---------------MDANQNQIQMEAQARKQKIIIQNQMILNASHQQQQQ 408
            ..:....|.::|:|               .:.|:|.|....|.      :...:..::|....:.
plant   218 DVEVNHGNINQNHQQRQLNTTSSQLDQPGFNTNRNNIAFLGQT------LPTNVFASSSSPSPRS 276

  Fly   409 PQQHPQQQQHQQQQQQHVAHGKKAARKHQQHLQQQ--------QQQQQQQQQQQQQQQQQTSAPM 465
            .....|...|.|.|.           .||..|.:.        |:...:.|::.:.:...::..:
plant   277 ASDSLQNLWHLQGQS-----------SHQWLLNENNNNNNNILQRGISKNQEEHEMKNVISNGSL 330

  Fly   466 YNNNSSSNHNGNNQSQEVSVPVSHIIANSPTAATYMQAQL-----SEHASNMQ-HGMPIVTYNGN 524
            :::.:.:|.|..||:.      ..|.:.|.||.....||:     |..:||.: .|:....:|..
plant   331 FSSEARNNTNNYNQNG------GQIASMSATALLQKAAQMGSKRSSSSSSNSKTFGLMTSIFNNK 389

  Fly   525 Q 525
            |
plant   390 Q 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12071NP_651832.3 zf-C2H2 185..207 CDD:278523 0/21 (0%)
C2H2 Zn finger 187..207 CDD:275368 0/19 (0%)
zf-H2C2_2 200..224 CDD:290200 8/23 (35%)
C2H2 Zn finger 215..232 CDD:275368 9/16 (56%)
AT3G45260NP_001327332.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2683
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.