DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12071 and IDD4

DIOPT Version :9

Sequence 1:NP_651832.3 Gene:CG12071 / 43660 FlyBaseID:FBgn0039808 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001325405.1 Gene:IDD4 / 814739 AraportID:AT2G02080 Length:516 Species:Arabidopsis thaliana


Alignment Length:434 Identity:76/434 - (17%)
Similarity:139/434 - (32%) Gaps:149/434 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 LQQVQQASSGV-----RKTNPSKSTNKAFECTVCGKGLARKDKLTIHMRIHTGEKPYICEVCNKA 221
            :..:||.:|..     |:..|......|....:..|.|...::             :||:||||.
plant    40 MSMIQQPNSSAPPPKKRRNQPGNPNPDAEVVALSPKTLMATNR-------------FICDVCNKG 91

  Fly   222 FARRDKLVIHMNKFKHVTPTNIAPLGKRLNNMVKKKEQPDPPP----EDNKQSLELQLQQQAVQV 282
            |.|...|.:|  :..|..|..   |.::....||:|....|.|    .|..::|           
plant    92 FQREQNLQLH--RRGHNLPWK---LKQKSTKEVKRKVYLCPEPTCVHHDPSRAL----------- 140

  Fly   283 AAQNIIVQSAQGAPTSIPGIIIPHHQQQLSWTCELCGRMFSSRDEWSIHAK-------------- 333
                       |..|.|.......|.:: .|.||.|.:.::.:.:|..|:|              
plant   141 -----------GDLTGIKKHYYRKHGEK-KWKCEKCSKRYAVQSDWKAHSKTCGTKEYRCDCGTI 193

  Fly   334 --------SHLEYXQPERLVAES--------TKPAAAAAGV--------------IAKTTSSNNS 368
                    :|..:   :.|:.|:        |...||::||              ::....|::.
plant   194 FSRRDSYITHRAFC--DALIQETARNPTVSFTSMTAASSGVGSGGIYGRLGGGSALSHHHLSDHP 256

  Fly   369 R---------NYQMDANQNQIQMEAQARKQKIIIQ---NQMILNASHQQQQQPQQHPQQQQHQQQ 421
            .         |..:.::.|:.....|:.....:||   :|.:||.:      |..:.|...:|  
plant   257 NFGFNPLVGYNLNIASSDNRRDFIPQSSNPNFLIQSASSQGMLNTT------PNNNNQSFMNQ-- 313

  Fly   422 QQQHVAHGKKAARKHQQHLQQQQQQQQQQQQ-------------QQQQQQQQTSAP-MYNNNSSS 472
                  ||.         :|.........:.             |:..:..:||.| :|:.:...
plant   314 ------HGL---------IQFDPVDNINLKSSGTNNSFFNLGFFQENTKNSETSLPSLYSTDVLV 363

  Fly   473 NHNGNNQSQEVSVPVSHIIANSPTAATYMQAQLSEHASNMQHGM 516
            :|...|.:...:|..:.::..    ||.|.:..|...|.:..|:
plant   364 HHREENLNAGSNVSATALLQK----ATQMGSVTSNDPSALFRGL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12071NP_651832.3 zf-C2H2 185..207 CDD:278523 2/21 (10%)
C2H2 Zn finger 187..207 CDD:275368 2/19 (11%)
zf-H2C2_2 200..224 CDD:290200 7/23 (30%)
C2H2 Zn finger 215..232 CDD:275368 8/16 (50%)
IDD4NP_001325405.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2683
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.