DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12071 and IDD5

DIOPT Version :9

Sequence 1:NP_651832.3 Gene:CG12071 / 43660 FlyBaseID:FBgn0039808 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001324413.1 Gene:IDD5 / 814738 AraportID:AT2G02070 Length:602 Species:Arabidopsis thaliana


Alignment Length:526 Identity:110/526 - (20%)
Similarity:163/526 - (30%) Gaps:203/526 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 YICEVCNKAFARRDKLVIHMNKFKHVTPTNIAPLGKRLNNMVKKKEQPDPPP----EDNKQSLEL 273
            :|||||||.|.|...|.:|  :..|..|..   |.::....||:|....|.|    .|..::|  
plant    81 FICEVCNKGFQREQNLQLH--RRGHNLPWK---LKQKSTKEVKRKVYLCPEPSCVHHDPSRAL-- 138

  Fly   274 QLQQQAVQVAAQNIIVQSAQGAPTSIPGIIIPHHQQQLSWTCELCGRMFSSRDEWSIHAK----- 333
                                |..|.|.......|.:: .|.|:.|.:.::.:.:|..|:|     
plant   139 --------------------GDLTGIKKHYYRKHGEK-KWKCDKCSKRYAVQSDWKAHSKTCGTK 182

  Fly   334 -----------------SHLEYXQPERLVAESTKPAAAAAGVIA-------KTTSSNNSRN---- 370
                             :|..:   :.|..||.:...:...:.:       .|.:|||:.:    
plant   183 EYRCDCGTLFSRRDSFITHRAFC--DALAQESARHPTSLTSLPSHHFPYGQNTNNSNNNASSMIL 245

  Fly   371 --YQMDANQNQIQME--------------AQARKQKIIIQNQMILNAS--HQQQQQPQQHPQQQQ 417
              ..|.|.||.....              |.:|....:|    ..|||  ..|:|.|..|.||..
plant   246 GLSHMGAPQNLDHQPGDVLRLGSGGGGGGAASRSSSDLI----AANASGYFMQEQNPSFHDQQDH 306

  Fly   418 HQQQQQQHVAHGKKAARKHQQHLQQQQQQQQQQQQQQQQQQQQTSAP--MYNNNSSSNHNG---- 476
            |...||..:|.....         :|.....||...|.......|||  ::|.:..|.:||    
plant   307 HHHHQQGFLAGNNNI---------KQSPMSFQQNLMQFSHDNHNSAPSNVFNLSFLSGNNGVTSA 362

  Fly   477 -NNQSQEVSVPVSH---IIAN-------------------------------------------- 493
             :|.:...:..||.   :|:|                                            
plant   363 TSNPNAAAAAAVSSGNLMISNHYDGENAVGGGGEGSTGLFPNNLMSSADRISSGSVPSLFSSSMQ 427

  Fly   494 SPTAATYMQ--------AQLSEHASNMQHGMPIVTYNGNQYCVITRA-------------PDLDV 537
            ||.:|.:|.        ||:...:||..:|..  |.|.|....|.|:             .|| :
plant   428 SPNSAPHMSATALLQKAAQMGSTSSNNNNGSN--TNNNNNASSILRSFGSGIYGENESNLQDL-M 489

  Fly   538 EAMQKPLDYGHAAG--------GATNIIVMSPMQLLP-------------------PQQQQQQPQ 575
            .:...|...|:..|        |..|..:.:..|.:.                   .||||||.|
plant   490 NSFSNPGATGNVNGVDSPFGSYGGVNKGLSADKQSMTRDFLGVGQIVKSMSGSGGFQQQQQQQQQ 554

  Fly   576 QQQQQQ 581
            ||||||
plant   555 QQQQQQ 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12071NP_651832.3 zf-C2H2 185..207 CDD:278523
C2H2 Zn finger 187..207 CDD:275368
zf-H2C2_2 200..224 CDD:290200 8/10 (80%)
C2H2 Zn finger 215..232 CDD:275368 9/16 (56%)
IDD5NP_001324413.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2683
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.