DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12071 and znf1001

DIOPT Version :9

Sequence 1:NP_651832.3 Gene:CG12071 / 43660 FlyBaseID:FBgn0039808 Length:581 Species:Drosophila melanogaster
Sequence 2:XP_021327400.1 Gene:znf1001 / 798047 ZFINID:ZDB-GENE-080213-7 Length:337 Species:Danio rerio


Alignment Length:186 Identity:46/186 - (24%)
Similarity:74/186 - (39%) Gaps:19/186 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 QQVQQASSGVRKTNPSKSTNKAFECTVCGKGLARKDKLTIHMRIHTGEKPYICEVCNKAF----A 223
            :::.|.:..:::.:..:.|     ||.|||.|..|..|..||||||||||:.|..|.|:|    .
Zfish     8 EKISQKTDSLKRKDKERVT-----CTQCGKSLTNKQSLGKHMRIHTGEKPFTCTQCGKSFRASST 67

  Fly   224 RRDKLVIHMNKFKH------VTPTNIAPLGKRLNNMVKKKEQPDPPPEDNKQSLELQLQQQAVQV 282
            ..:.::||..:..|      .|....:.|...|:...|:|..|....|.:.:........|.:..
Zfish    68 LNNHMLIHTGEKTHKCDQCGKTFLRDSELKNHLSVHTKEKLYPCSVCEKSFRHQRSLRNHQKIHT 132

  Fly   283 AAQNIIVQSAQGAPTSIPGIIIPH---HQQQLSWTCELCGRMFSSRDEWSIHAKSH 335
            ..........:....:...:.| |   |..:..:.|.||.:.||.......||:.|
Zfish   133 GVGEYKCFECEKTFCTAESLKI-HKRIHTGEKPYICSLCNKRFSQLAHMKTHARIH 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12071NP_651832.3 zf-C2H2 185..207 CDD:278523 11/21 (52%)
C2H2 Zn finger 187..207 CDD:275368 11/19 (58%)
zf-H2C2_2 200..224 CDD:290200 15/27 (56%)
C2H2 Zn finger 215..232 CDD:275368 5/20 (25%)
znf1001XP_021327400.1 COG5048 27..327 CDD:227381 44/162 (27%)
C2H2 Zn finger 27..47 CDD:275368 11/19 (58%)
C2H2 Zn finger 55..75 CDD:275368 4/19 (21%)
C2H2 Zn finger 83..103 CDD:275368 3/19 (16%)
C2H2 Zn finger 111..131 CDD:275368 2/19 (11%)
C2H2 Zn finger 139..159 CDD:275368 2/20 (10%)
C2H2 Zn finger 167..187 CDD:275368 7/19 (37%)
C2H2 Zn finger 195..215 CDD:275368
SFP1 <222..323 CDD:227516
C2H2 Zn finger 223..243 CDD:275368
C2H2 Zn finger 251..271 CDD:275368
C2H2 Zn finger 279..299 CDD:275368
C2H2 Zn finger 307..327 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000003
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.