DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12071 and CG7691

DIOPT Version :9

Sequence 1:NP_651832.3 Gene:CG12071 / 43660 FlyBaseID:FBgn0039808 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_650728.1 Gene:CG7691 / 42228 FlyBaseID:FBgn0038626 Length:283 Species:Drosophila melanogaster


Alignment Length:168 Identity:46/168 - (27%)
Similarity:64/168 - (38%) Gaps:41/168 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 HYAATIKVPQISSSNVAAAAAGESTFTVPDDGMGFEGGVRVLQSLGTWSAAEQLTYNIPK--PNL 140
            |....:|:|            |||..::|....|.:.|:     :...:.::|....:.:  |.|
  Fly   109 HTIWELKMP------------GESFDSIPKTRNGIKVGI-----ITVTAESKQTRTKLKRKGPIL 156

  Fly   141 IPFTEPYVEGGSMHPASRLKALQQVQQASSGVRKTNPSKSTNK----AFECTVCGKGLARKDKLT 201
            ...|.|          |.:..:..:||     ||. |.|...|    .|||..|.|.......||
  Fly   157 ANVTVP----------SNIVEIPPIQQ-----RKM-PEKRRLKRVGGQFECIDCDKKFDHSWMLT 205

  Fly   202 IHMRIHTGEKPYICE--VCNKAFARRDKLVIHMNKFKH 237
            .|.|.||||||::|.  .|.|||:.|..|..|.....|
  Fly   206 AHTRTHTGEKPFVCPDGSCRKAFSDRSNLRSHQRTMGH 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12071NP_651832.3 zf-C2H2 185..207 CDD:278523 9/21 (43%)
C2H2 Zn finger 187..207 CDD:275368 7/19 (37%)
zf-H2C2_2 200..224 CDD:290200 15/25 (60%)
C2H2 Zn finger 215..232 CDD:275368 7/18 (39%)
CG7691NP_650728.1 COG5048 188..>271 CDD:227381 24/56 (43%)
C2H2 Zn finger 191..211 CDD:275368 7/19 (37%)
zf-H2C2_2 203..229 CDD:290200 14/25 (56%)
C2H2 Zn finger 219..244 CDD:275368 9/25 (36%)
C2H2 Zn finger 250..266 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.