Sequence 1: | NP_651832.3 | Gene: | CG12071 / 43660 | FlyBaseID: | FBgn0039808 | Length: | 581 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001262393.1 | Gene: | ich / 41069 | FlyBaseID: | FBgn0286204 | Length: | 592 | Species: | Drosophila melanogaster |
Alignment Length: | 206 | Identity: | 49/206 - (23%) |
---|---|---|---|
Similarity: | 71/206 - (34%) | Gaps: | 82/206 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 40 NSPTANNNNNSQNNG-----NMQQQQQQQQQQQQQQQQQQQQQHYAATIKVPQISSSNVAAAAAG 99
Fly 100 ESTFTVPDDGMGFEGGVRVLQSLGTWSAAEQLTYNIPKPNLIPFTEPYVEG--GSMHPASRLKAL 162
Fly 163 QQVQQASSGVRKTNPSKSTNKAFECTVCGKGLARKDKLTIHMRIHTGEKPYICEVCNKAFARRDK 227
Fly 228 LVIHMNKFKHV 238 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12071 | NP_651832.3 | zf-C2H2 | 185..207 | CDD:278523 | 6/21 (29%) |
C2H2 Zn finger | 187..207 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 200..224 | CDD:290200 | 14/23 (61%) | ||
C2H2 Zn finger | 215..232 | CDD:275368 | 7/16 (44%) | ||
ich | NP_001262393.1 | C2H2 Zn finger | 538..558 | CDD:275368 | 6/19 (32%) |
zf-H2C2_2 | 550..575 | CDD:316026 | 14/24 (58%) | ||
C2H2 Zn finger | 566..586 | CDD:275368 | 8/19 (42%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24393 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |