DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12071 and ich

DIOPT Version :9

Sequence 1:NP_651832.3 Gene:CG12071 / 43660 FlyBaseID:FBgn0039808 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_001262393.1 Gene:ich / 41069 FlyBaseID:FBgn0286204 Length:592 Species:Drosophila melanogaster


Alignment Length:206 Identity:49/206 - (23%)
Similarity:71/206 - (34%) Gaps:82/206 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 NSPTANNNNNSQNNG-----NMQQQQQQQQQQQQQQQQQQQQQHYAATIKVPQISSSNVAAAAAG 99
            ::.||:...:....|     ..:.|::..|||||||||||||.........||:|       |..
  Fly   459 HTTTASTTGSEMRTGAPKAKRSRSQKKSNQQQQQQQQQQQQQGDGGGQPTTPQMS-------AIS 516

  Fly   100 ESTFTVPDDGMGFEGGVRVLQSLGTWSAAEQLTYNIPKPNLIPFTEPYVEG--GSMHPASRLKAL 162
            .|.|:..|                                        :.|  |...|..|    
  Fly   517 PSGFSASD----------------------------------------LSGLLGKEKPVHR---- 537

  Fly   163 QQVQQASSGVRKTNPSKSTNKAFECTVCGKGLARKDKLTIHMRIHTGEKPYICEVCNKAFARRDK 227
                                    |::|.:|...|..:.:|:|.||||||:.|:||.|||.::..
  Fly   538 ------------------------CSICNRGFLNKSNIKVHLRTHTGEKPFRCDVCAKAFRQKAH 578

  Fly   228 LVIHMNKFKHV 238
            |:.|....|.:
  Fly   579 LLKHQQIHKRI 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12071NP_651832.3 zf-C2H2 185..207 CDD:278523 6/21 (29%)
C2H2 Zn finger 187..207 CDD:275368 6/19 (32%)
zf-H2C2_2 200..224 CDD:290200 14/23 (61%)
C2H2 Zn finger 215..232 CDD:275368 7/16 (44%)
ichNP_001262393.1 C2H2 Zn finger 538..558 CDD:275368 6/19 (32%)
zf-H2C2_2 550..575 CDD:316026 14/24 (58%)
C2H2 Zn finger 566..586 CDD:275368 8/19 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.