DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12071 and rst2

DIOPT Version :9

Sequence 1:NP_651832.3 Gene:CG12071 / 43660 FlyBaseID:FBgn0039808 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_593288.1 Gene:rst2 / 2543031 PomBaseID:SPAC6F12.02 Length:567 Species:Schizosaccharomyces pombe


Alignment Length:556 Identity:100/556 - (17%)
Similarity:165/556 - (29%) Gaps:209/556 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 SAAEQLTYNIPKPNLIPFTEPYVEGGSMHPASRLKALQQVQQASSGVRKTNPSKSTNKAFECTVC 190
            |.|..|:.:....||:..........:..|:|.....:.|..:::..:..|......|.:.|..|
pombe    11 SKANTLSESKVSENLMSINSDSGTSNANTPSSVTSNSKPVASSTAAKKDPNAPPQKVKQYVCETC 75

  Fly   191 GKGLARKDKLTIHMRIHTGEKPYIC-EV------CNKAFARRDKLVIHMNKFKH----------- 237
            .:..||.:.|..|:|.||.|||:.| |:      |.:.|:|||.|:.|..|...           
pombe    76 TRAFARLEHLKRHIRSHTNEKPFTCSEIDGLPTGCGRQFSRRDLLLRHQQKIHRNPQPRRRRRST 140

  Fly   238 ------------VTPTNIAPLGKRLNNMVKKKEQPDPPPEDNKQSLELQLQQQAVQ--------- 281
                        |:.||:|      :..|....|.|...:.....|...||.|...         
pombe   141 TALPNPSLSNVSVSTTNLA------SKPVISLPQADSIDKFRYPKLHAALQAQLANNSGSFSASW 199

  Fly   282 -VAAQNIIVQSAQGAPT---SIPGIIIPHHQQQLSWTCELCG-------------RMFSSRDEWS 329
             .|.|..:|.:..|..|   |..|.:.|...|   |:.:..|             ...:|....|
pombe   200 LQAQQQRLVSAGNGRETVNASASGAVNPTSSQ---WSDQRLGVPYGPDSPLYYRRATIASDLRPS 261

  Fly   330 IHAKSHL-EYXQPERLVAESTKPAAAAAGVIAKTTSSNN--SRNYQM------------------ 373
            ::....| :: :||.|..:....:      :|:...|.|  ||||.|                  
pombe   262 VYQHPQLYDFNRPESLSGQLDDES------LARMPYSPNAVSRNYAMNMTLPESIPEGYEIDKLD 320

  Fly   374 --------------------DANQNQIQMEAQ-----ARKQKII-------IQN---------QM 397
                                |.:.:.:.::|.     :.|..:|       .||         ..
pombe   321 WMSFSESLNLPTFNQPSGPSDVSASFLNLQAMPSPHASPKDSLINKSNSYFFQNPPKSNSVDYTR 385

  Fly   398 ILNASHQQQ---------------------QQP------------------------QQHPQQQQ 417
            :.|..|.:|                     |||                        :|:|.:..
pombe   386 LDNLEHMRQSCISPSGTNFSPSCYSPESLMQQPLTLSPSSIPSGLPTYAHVNSPLGTEQYPSEAY 450

  Fly   418 HQQ---QQQQHVAHG-KKAARKHQQHLQQQQQ--------------------------QQQQQQQ 452
            ..:   ..:..::.| |:......:.:..:.|                          .|.:...
pombe   451 PPKGYVDMEGRISEGIKEEGISLSEEITDKDQAFASMGYFDSYNFEGVENSNSLNNEGDQMETNF 515

  Fly   453 QQQQQQQQTSAPMYNNNSSSNHNGNNQSQEVSVPVS 488
            |.::.....|.|.:|.| |.|:||.|.|.:.:.|||
pombe   516 QSEKLDNSNSIPFFNFN-SFNNNGANWSSDFNYPVS 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12071NP_651832.3 zf-C2H2 185..207 CDD:278523 7/21 (33%)
C2H2 Zn finger 187..207 CDD:275368 7/19 (37%)
zf-H2C2_2 200..224 CDD:290200 12/30 (40%)
C2H2 Zn finger 215..232 CDD:275368 8/23 (35%)
rst2NP_593288.1 COG5048 37..547 CDD:227381 92/525 (18%)
zf-C2H2 70..92 CDD:278523 7/21 (33%)
C2H2 Zn finger 72..92 CDD:275368 7/19 (37%)
zf-H2C2_2 84..116 CDD:290200 12/31 (39%)
C2H2 Zn finger 100..128 CDD:275368 10/27 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I1865
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.