DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12071 and sfc2

DIOPT Version :9

Sequence 1:NP_651832.3 Gene:CG12071 / 43660 FlyBaseID:FBgn0039808 Length:581 Species:Drosophila melanogaster
Sequence 2:NP_594670.1 Gene:sfc2 / 2542887 PomBaseID:SPAC144.09c Length:374 Species:Schizosaccharomyces pombe


Alignment Length:412 Identity:80/412 - (19%)
Similarity:126/412 - (30%) Gaps:167/412 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 KSTNKAFECTV--CGKGLARKDKLTIHMRIHTGEKPYICEV--CNKAFARRDKLVIHMNKFKHVT 239
            :|..|.|.|..  |||..:|...|..|:|.|:.|:|::|:.  |:|||.|:..|.||  |..|  
pombe    17 RSAKKIFHCPYEECGKKYSRPSLLEQHLRTHSNERPFVCDYTGCSKAFYRKSHLKIH--KRCH-- 77

  Fly   240 PTNIAPLG-------------KRLNNMVKKKEQPDP----------------------------- 262
             ||:.|..             :.|...::...:|.|                             
pombe    78 -TNVKPFSCHYDGCDAQFYTQQHLERHIEVHRKPKPYACTWEGCDECFSKHQQLRSHISACHTHL 141

  Fly   263 -PPEDNKQSLEL-----QLQQQAVQVAAQNIIVQSAQGAPTSIPGIIIPH-----HQQQLSW--- 313
             |.....|..||     |..|..|..|.:.||..|.            ||     |:....|   
pombe   142 LPYPCTYQDCELRFATKQKLQNHVNRAHEKIISYSC------------PHESCVGHEGFEKWSQL 194

  Fly   314 ----------TCELCGRMFSSRDEWSIHAKSHLEYXQPERLVAESTKPAAAAAGVIAKTTSSNNS 368
                      :|.:|||.|.:    :.|.:.|                      |:...|:....
pombe   195 QNHIREAHVPSCSICGRQFKT----AAHLRHH----------------------VVLHQTTLEER 233

  Fly   369 RNYQ--MDANQNQIQMEAQARKQKIIIQNQMILNASHQQQQQPQQHPQQQQHQQQQQQHV-AHGK 430
            :.|.  |:..:......:..:|...:|                        |:.....|. :.|.
pombe   234 KTYHCPMEGCKKSFTRSSALKKHISVI------------------------HEGNMAFHCDSCGT 274

  Fly   431 KAARKH--QQHLQQQQQQQQQQQQQQQQQQQQTSAPMYNNNSSSNHNG-------NNQSQEVS-- 484
            |...||  |:||::...::..:.              |.|.....|:|       :.:.:|:|  
pombe   275 KFGYKHMLQRHLERGTCKKAHKP--------------YINECGIKHDGIEGVAIHDQKEKELSSN 325

  Fly   485 --VPVSHIIANSPTAATYMQAQ 504
              ..|:..|.|..|...|.:|:
pombe   326 LVSDVAKKIINEVTGHGYKEAR 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12071NP_651832.3 zf-C2H2 185..207 CDD:278523 9/23 (39%)
C2H2 Zn finger 187..207 CDD:275368 8/21 (38%)
zf-H2C2_2 200..224 CDD:290200 11/25 (44%)
C2H2 Zn finger 215..232 CDD:275368 8/18 (44%)
sfc2NP_594670.1 COG5048 1..374 CDD:227381 80/412 (19%)
C2H2 Zn finger 28..47 CDD:275368 7/18 (39%)
C2H2 Zn finger 55..77 CDD:275368 10/23 (43%)
C2H2 Zn finger 85..107 CDD:275368 1/21 (5%)
C2H2 Zn finger 115..138 CDD:275368 0/22 (0%)
C2H2 Zn finger 146..165 CDD:275368 5/18 (28%)
C2H2 Zn finger 206..226 CDD:275368 8/45 (18%)
C2H2 Zn finger 238..261 CDD:275368 3/46 (7%)
C2H2 Zn finger 269..286 CDD:275368 5/16 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24393
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.