Sequence 1: | NP_651832.3 | Gene: | CG12071 / 43660 | FlyBaseID: | FBgn0039808 | Length: | 581 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017208828.1 | Gene: | si:ch73-138e16.3 / 100006019 | ZFINID: | ZDB-GENE-070705-202 | Length: | 290 | Species: | Danio rerio |
Alignment Length: | 196 | Identity: | 46/196 - (23%) |
---|---|---|---|
Similarity: | 69/196 - (35%) | Gaps: | 66/196 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 179 KSTNKAFECTVCGKGLARKDKLTIHMRIHTGEKPYICEVCNKAFARRDKLVIHM----------- 232
Fly 233 ----NKFKHVT-------------PTNIAPLGKRLNN--------MVKKKEQPDPPPEDNK---Q 269
Fly 270 SLELQLQQQAVQVAAQNIIVQSAQGAPTSIPGIIIPHHQQQLSWTCELCGRMFSSRDEWSIHAKS 334
Fly 335 H 335 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12071 | NP_651832.3 | zf-C2H2 | 185..207 | CDD:278523 | 12/21 (57%) |
C2H2 Zn finger | 187..207 | CDD:275368 | 11/19 (58%) | ||
zf-H2C2_2 | 200..224 | CDD:290200 | 16/23 (70%) | ||
C2H2 Zn finger | 215..232 | CDD:275368 | 5/16 (31%) | ||
si:ch73-138e16.3 | XP_017208828.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000003 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |