DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12071 and si:ch73-138e16.3

DIOPT Version :9

Sequence 1:NP_651832.3 Gene:CG12071 / 43660 FlyBaseID:FBgn0039808 Length:581 Species:Drosophila melanogaster
Sequence 2:XP_017208828.1 Gene:si:ch73-138e16.3 / 100006019 ZFINID:ZDB-GENE-070705-202 Length:290 Species:Danio rerio


Alignment Length:196 Identity:46/196 - (23%)
Similarity:69/196 - (35%) Gaps:66/196 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 KSTNKAFECTVCGKGLARKDKLTIHMRIHTGEKPYICEVCNKAFARRDKLVIHM----------- 232
            :...|.|.||.|||.|..|..|.:|||||||||||.|..|.|:|.:...|..||           
Zfish     3 RKDKKCFTCTECGKSLGSKHCLQLHMRIHTGEKPYTCTECGKSFRQSSALKSHMLIHTGGKPYTC 67

  Fly   233 ----NKFKHVT-------------PTNIAPLGKRLNN--------MVKKKEQPDPPPEDNK---Q 269
                ..|:|::             |......||..:.        |:...|:|......:|   :
Zfish    68 TQCGKSFRHLSNFKKHMLIHTGEKPFTCTQCGKSFSRSTHFNEHMMIHTGERPHTCDRCDKTFLR 132

  Fly   270 SLELQLQQQAVQVAAQNIIVQSAQGAPTSIPGIIIPHHQQQLSWTCELCGRMFSSRDEWSIHAKS 334
            :.:|::..:.                           |.::..::|..||:.|..:.....|.|.
Zfish   133 AADLKIHLRV---------------------------HTKEKPYSCSECGKSFGRQSSLKDHQKI 170

  Fly   335 H 335
            |
Zfish   171 H 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12071NP_651832.3 zf-C2H2 185..207 CDD:278523 12/21 (57%)
C2H2 Zn finger 187..207 CDD:275368 11/19 (58%)
zf-H2C2_2 200..224 CDD:290200 16/23 (70%)
C2H2 Zn finger 215..232 CDD:275368 5/16 (31%)
si:ch73-138e16.3XP_017208828.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000003
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.