DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr100A and Cpr78Ca

DIOPT Version :9

Sequence 1:NP_651829.1 Gene:Cpr100A / 43657 FlyBaseID:FBgn0039805 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_649298.2 Gene:Cpr78Ca / 40352 FlyBaseID:FBgn0037067 Length:127 Species:Drosophila melanogaster


Alignment Length:104 Identity:28/104 - (26%)
Similarity:42/104 - (40%) Gaps:6/104 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFRFLALTTLVALASSQHYHQDPKTAAIISEQRYLSGD-----GKFGAAYEQEDGINFKEETDAD 60
            |..|..:...:.|...|..|....||..:....|....     |.:...::..:||..|...:.:
  Fly     1 MMSFGKIVVFLVLVLVQLIHCTRFTAPSLDRTIYYRNTPPDPFGHYSFEFQTTNGITTKGAGNEN 65

  Fly    61 GTRHGSYSYLDPTGQRRTISYTAGKNGFQASGDHLPQAP 99
            |. .|...::.|.|...|.||.|..||:|.:|||:|..|
  Fly    66 GA-VGVVQFVSPEGIPVTFSYVADANGYQPTGDHIPAIP 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr100ANP_651829.1 Chitin_bind_4 44..88 CDD:278791 12/43 (28%)
Cpr78CaNP_649298.2 Chitin_bind_4 46..92 CDD:278791 12/46 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.