DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr100A and Acp65Aa

DIOPT Version :10

Sequence 1:NP_651829.1 Gene:Cpr100A / 43657 FlyBaseID:FBgn0039805 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster


Alignment Length:100 Identity:33/100 - (33%)
Similarity:53/100 - (53%) Gaps:12/100 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ALTTLVALASSQHYHQDPKTAAIISEQRYLSGDGKFGAAYEQEDGINFKEE-------TDADG-T 62
            ::..|:||||::. ..|.:.....||.   :|.|.:..:|:..||.:..||       ||.:. :
  Fly    10 SIALLLALASARP-QNDVEVLEYESEN---TGLGGYKFSYKLSDGTSRTEEGVVNNAGTDNESIS 70

  Fly    63 RHGSYSYLDPTGQRRTISYTAGKNGFQASGDHLPQ 97
            ..||.:::.|.||..||::.|.:||||..|.|||:
  Fly    71 IRGSVTWVAPDGQTYTINFVADENGFQPEGAHLPK 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr100ANP_651829.1 Chitin_bind_4 44..88 CDD:459790 16/51 (31%)
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:459790 16/54 (30%)

Return to query results.
Submit another query.