DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Cpr100A and l(3)mbn

DIOPT Version :9

Sequence 1:	NP_651829.1	Gene:	Cpr100A / 43657	FlyBaseID:	FBgn0039805	Length:	241	Species:	Drosophila melanogaster
Sequence 2:	NP_729143.2	Gene:	l(3)mbn / 38701	FlyBaseID:	FBgn0002440	Length:	653	Species:	Drosophila melanogaster

Alignment Length:	62	Identity:	21/62 - (33%)
Similarity:	28/62 - (45%)	Gaps:	9/62 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly    37 GDGKFGAAYEQEDGINFK--------EETDA-DGTRHGSYSYLDPTGQRRTISYTAGKNGFQ 89
            |.|:..|:....|...||        |||.. :|.:.|||..:.....:|||.|.|.:.|||
  Fly   561 GSGRGSASSATGDLYKFKYILDYNGHEETGGRNGDKQGSYFAIGEDAVQRTIEYIANEFGFQ 622

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Cpr100A	NP_651829.1	Chitin_bind_4	44..88	CDD:278791	15/52 (29%)
l(3)mbn	NP_729143.2	Chitin_bind_4	31..77	CDD:278791
l(3)mbn	NP_729143.2	Chitin_bind_4	575..621	CDD:278791	14/45 (31%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR10380
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.100