DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr100A and CG1136

DIOPT Version :9

Sequence 1:NP_651829.1 Gene:Cpr100A / 43657 FlyBaseID:FBgn0039805 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_647853.1 Gene:CG1136 / 38479 FlyBaseID:FBgn0035490 Length:458 Species:Drosophila melanogaster


Alignment Length:348 Identity:74/348 - (21%)
Similarity:100/348 - (28%) Gaps:154/348 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LTTLVALA---------SSQHYH----QDPKTAAIISEQRYLSGDGKFGAAYEQEDGINFKEETD 58
            |..|||||         |:..||    :.|        :||.        .::.:.|...||:..
  Fly     5 LLALVALAAVVTGSQTPSANQYHIQTDEGP--------ERYF--------RFQTDSGQFRKEKRL 53

  Fly    59 ADGTRHGSYSYLDPTGQRRTISYTAGKNGFQ---------------------------------- 89
            .|||..|:.:::|..|..|...|.|.|.|::                                  
  Fly    54 QDGTVIGTEAWIDAAGYLRQKDYIADKQGYRILKSKTIYVGLGRAVEDAIKSTKAAPAQSGVLVH 118

  Fly    90 --ASGD--------HLPQ-------------APPAPP----------------QPVPTAGYQPQQ 115
              :||.        |.|.             ||..||                .|...|..:||.
  Fly   119 GGSSGSSANSLGSYHRPSYGYISSTTSTTTPAPYPPPALLDVEDSGAGKLNYLPPEQAAKIEPQS 183

  Fly   116 Q----YQP-------QQYQAPAP----QPQASFRSNDYGDD---------GSYDPRYNDPSFGQN 156
            |    :.|       .|..:|.|    .|.....||  ||.         ..||.. .|.:||..
  Fly   184 QLGFDHYPDELPRARDQLLSPLPATPLSPLVDIHSN--GDPVQDLELNAINVYDAE-ADRAFGHG 245

  Fly   157 Q--QSYQQPAAQP--------------QYRPAPQPA------YNPQPVQPQQQYQPQYQQPQPQY 199
            |  .......|:|              :.||.|.||      ..|.|:.....|  .|..||| :
  Fly   246 QFGSVISSTTARPPSLDMLPPLSAHRRRLRPRPTPAPVAIVSSTPAPISGADLY--GYSTPQP-F 307

  Fly   200 QQPQPQQAYYTTTTPNPHRFSPP 222
            ..|..|.|...|::...:.:.||
  Fly   308 AAPAYQFAPPATSSTTGYGYYPP 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr100ANP_651829.1 Chitin_bind_4 44..88 CDD:278791 13/43 (30%)
CG1136NP_647853.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.