DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr100A and Cpr49Aa

DIOPT Version :10

Sequence 1:NP_651829.1 Gene:Cpr100A / 43657 FlyBaseID:FBgn0039805 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster


Alignment Length:127 Identity:48/127 - (37%)
Similarity:61/127 - (48%) Gaps:13/127 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ALTTLVALASSQHYHQDP-KTAAIISEQRYLSGDGKFGAAYEQEDGINFKEE-------TDADG- 61
            ||...:|.|..|...|.| :...||.:::.::.||.:...||..:|||.:||       ||..| 
  Fly    10 ALLLSLAQARPQVRGQAPGEPIPIIRQEQEVNFDGSYKYLYETGNGINAEEEGYLKNPGTDNAGQ 74

  Fly    62 TRHGSYSYLDPTGQRRTISYTAGKNGFQASGDHLPQAPPAPPQPVPTAGY----QPQQQYQP 119
            ...||:||..|.|....|:|.|.:||||..|||||..||.||.......|    .|..|.||
  Fly    75 VAQGSFSYTSPEGIPIRITYLADENGFQPQGDHLPTPPPIPPAIQKALAYLATAPPPPQEQP 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr100ANP_651829.1 Chitin_bind_4 44..88 CDD:459790 20/51 (39%)
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:459790 20/54 (37%)

Return to query results.
Submit another query.